BLASTX nr result
ID: Catharanthus23_contig00028912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00028912 (536 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006358523.1| PREDICTED: uncharacterized protein LOC102578... 60 3e-07 >ref|XP_006358523.1| PREDICTED: uncharacterized protein LOC102578579 [Solanum tuberosum] Length = 74 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 439 TKDDFMKAYKVWPSDEDRGRWVAEPGIDKKAS 534 ++DD +KAYKVWPSDEDRG+WVA+PGID KA+ Sbjct: 28 SRDDCVKAYKVWPSDEDRGQWVADPGIDNKAA 59