BLASTX nr result
ID: Catharanthus23_contig00028792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00028792 (770 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera] 45 5e-06 >emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera] Length = 1316 Score = 45.4 bits (106), Expect(2) = 5e-06 Identities = 18/44 (40%), Positives = 30/44 (68%) Frame = +1 Query: 637 LNIDDVLFIPKLRCNLLSLSQLSKENNYVIIINDGVLIL*DRIS 768 L + +VL++P L+CNL+S+ QL KE +Y++ D ++ DR S Sbjct: 310 LCLKNVLYVPSLKCNLISIGQLLKEKDYIVTFTDSFCVIQDRTS 353 Score = 31.6 bits (70), Expect(2) = 5e-06 Identities = 28/97 (28%), Positives = 42/97 (43%) Frame = +2 Query: 245 RGAELYSPGRGSSRRVADLHHSVKQERLAGAATTSSDDTPRSVSIPGLSPAQWTSFLNLL 424 RG Y+ GRG++ ++V + D R++ IPGL+ + + LL Sbjct: 183 RGRNSYA-GRGATSGRVHYXNAVAEADTQEKGQCVGHDVERNI-IPGLNDDNFQKLMALL 240 Query: 425 NKQNXXXXXXXXXXXXKIEKDCILDSEHSHHMKDRRD 535 +N KI ++ ILDS S HM RRD Sbjct: 241 --RNGSSNAEKLTGKNKIVEEWILDSGASMHMTGRRD 275