BLASTX nr result
ID: Catharanthus23_contig00028740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00028740 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469117.1| PREDICTED: putative ribonuclease H protein A... 57 3e-06 >ref|XP_006469117.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus sinensis] Length = 491 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/83 (34%), Positives = 42/83 (50%) Frame = +2 Query: 152 DNICKLCSKEPETLLHALRDCT*CSPIWKRLVRRSEWWDFSIARSTQEWIDFNLHNSREA 331 D C C ET LH LRDC +W +L+ SEW + + +W+ NL S + Sbjct: 314 DWTCDHCGVASETTLHVLRDCFMAKRLWNQLL-PSEWRQVFFSSNLLDWLTLNL-RSNQC 371 Query: 332 SENNLKWSILFKEVVNSVWY*RN 400 EN L+WS +F + +W+ RN Sbjct: 372 MENGLEWSCMFGVAIWRLWFWRN 394