BLASTX nr result
ID: Catharanthus23_contig00028546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00028546 (407 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64595.1| hypothetical protein M569_10185, partial [Genlise... 60 1e-09 sp|A5AEC8.1|ARGJ_VITVI RecName: Full=Arginine biosynthesis bifun... 59 4e-09 ref|XP_002274213.2| PREDICTED: arginine biosynthesis bifunctiona... 59 4e-09 gb|EOY07598.1| Arginine biosynthesis protein ArgJ family [Theobr... 56 2e-08 ref|XP_006846096.1| hypothetical protein AMTR_s00012p00117440 [A... 56 3e-08 ref|XP_006341058.1| PREDICTED: arginine biosynthesis bifunctiona... 54 1e-07 ref|XP_006341059.1| PREDICTED: arginine biosynthesis bifunctiona... 54 1e-07 ref|XP_004246463.1| PREDICTED: arginine biosynthesis bifunctiona... 54 1e-07 ref|XP_006376966.1| arginine biosynthesis protein ArgJ [Populus ... 53 2e-07 ref|XP_002332319.1| predicted protein [Populus trichocarpa] 53 2e-07 ref|XP_002531335.1| arginine biosynthesis protein argJ 1, putati... 53 2e-07 ref|YP_008900063.1| bifunctional ornithine acetyltransferase / N... 54 2e-07 ref|XP_006480793.1| PREDICTED: arginine biosynthesis bifunctiona... 52 3e-07 ref|XP_006429063.1| hypothetical protein CICLE_v10011653mg [Citr... 52 3e-07 ref|XP_006480794.1| PREDICTED: arginine biosynthesis bifunctiona... 52 3e-07 ref|XP_006429062.1| hypothetical protein CICLE_v10011653mg [Citr... 52 3e-07 ref|XP_006429061.1| hypothetical protein CICLE_v10011653mg [Citr... 52 3e-07 ref|XP_002881511.1| arginine biosynthesis protein ArgJ family [A... 51 6e-07 ref|XP_004984760.1| PREDICTED: arginine biosynthesis bifunctiona... 53 6e-07 ref|XP_005645647.1| putative arginine biosynthesis bifunctional ... 53 6e-07 >gb|EPS64595.1| hypothetical protein M569_10185, partial [Genlisea aurea] Length = 436 Score = 60.1 bits (144), Expect(2) = 1e-09 Identities = 25/61 (40%), Positives = 43/61 (70%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDRKKILLFCTQS*HHQSLLI 206 P GR++ AGYAG+ FDP+ L IS+G+++ M++GQP+PFDRK++ + + +++ Sbjct: 345 PNWGRIACAAGYAGVAFDPDDLRISVGDVVLMEDGQPVPFDRKRVSSYLRGKGEERGVVV 404 Query: 205 V 203 V Sbjct: 405 V 405 Score = 27.7 bits (60), Expect(2) = 1e-09 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 338 AAVYGRDPNW 347 >sp|A5AEC8.1|ARGJ_VITVI RecName: Full=Arginine biosynthesis bifunctional protein ArgJ, chloroplastic; Includes: RecName: Full=Glutamate N-acetyltransferase; Short=GAT; AltName: Full=Ornithine acetyltransferase; Short=OATase; AltName: Full=Ornithine transacetylase; Includes: RecName: Full=Amino-acid acetyltransferase; AltName: Full=N-acetylglutamate synthase; Short=AGS; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ alpha chain; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ beta chain; Flags: Precursor gi|147801761|emb|CAN77854.1| hypothetical protein VITISV_037692 [Vitis vinifera] Length = 510 Score = 58.5 bits (140), Expect(2) = 4e-09 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR++ AGYAGI F PN L ISLG IL M+ GQPLPFDR Sbjct: 419 PNWGRIACAAGYAGIPFQPNKLHISLGEILLMEGGQPLPFDR 460 Score = 27.7 bits (60), Expect(2) = 4e-09 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 412 AAVYGRDPNW 421 >ref|XP_002274213.2| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Vitis vinifera] gi|297741477|emb|CBI32609.3| unnamed protein product [Vitis vinifera] Length = 470 Score = 58.5 bits (140), Expect(2) = 4e-09 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR++ AGYAGI F PN L ISLG IL M+ GQPLPFDR Sbjct: 379 PNWGRIACAAGYAGIPFQPNKLHISLGEILLMEGGQPLPFDR 420 Score = 27.7 bits (60), Expect(2) = 4e-09 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 372 AAVYGRDPNW 381 >gb|EOY07598.1| Arginine biosynthesis protein ArgJ family [Theobroma cacao] Length = 469 Score = 56.2 bits (134), Expect(2) = 2e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGY+GI FDPN L I LG+I+ MD GQPL FDR Sbjct: 378 PNWGRIAAAAGYSGISFDPNNLQILLGDIMLMDGGQPLAFDR 419 Score = 27.7 bits (60), Expect(2) = 2e-08 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 371 AAVYGRDPNW 380 >ref|XP_006846096.1| hypothetical protein AMTR_s00012p00117440 [Amborella trichopoda] gi|548848866|gb|ERN07771.1| hypothetical protein AMTR_s00012p00117440 [Amborella trichopoda] Length = 459 Score = 55.8 bits (133), Expect(2) = 3e-08 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR++ GYAG+ F PN L ISLG IL MD GQPLPFDR Sbjct: 368 PNWGRIACSVGYAGVPFIPNELRISLGGILLMDGGQPLPFDR 409 Score = 27.7 bits (60), Expect(2) = 3e-08 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 361 AAVYGRDPNW 370 >ref|XP_006341058.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 472 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR++ AGYAGI F+ + L ISLG+I+ M+ GQPLPFDR Sbjct: 381 PNWGRIACAAGYAGIPFNADKLRISLGDIVLMEAGQPLPFDR 422 Score = 27.7 bits (60), Expect(2) = 1e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 374 AAVYGRDPNW 383 >ref|XP_006341059.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 470 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR++ AGYAGI F+ + L ISLG+I+ M+ GQPLPFDR Sbjct: 379 PNWGRIACAAGYAGIPFNADKLRISLGDIVLMEAGQPLPFDR 420 Score = 27.7 bits (60), Expect(2) = 1e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 372 AAVYGRDPNW 381 >ref|XP_004246463.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Solanum lycopersicum] Length = 470 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR++ AGYAGI F+ + L ISLG+I+ M+ GQPLPFDR Sbjct: 379 PNWGRIACAAGYAGIPFNADKLRISLGDIVLMEAGQPLPFDR 420 Score = 27.7 bits (60), Expect(2) = 1e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 372 AAVYGRDPNW 381 >ref|XP_006376966.1| arginine biosynthesis protein ArgJ [Populus trichocarpa] gi|586830441|sp|B9NAN0.2|ARGJ_POPTR RecName: Full=Arginine biosynthesis bifunctional protein ArgJ, chloroplastic; Includes: RecName: Full=Glutamate N-acetyltransferase; Short=GAT; AltName: Full=Ornithine acetyltransferase; Short=OATase; AltName: Full=Ornithine transacetylase; Includes: RecName: Full=Amino-acid acetyltransferase; AltName: Full=N-acetylglutamate synthase; Short=AGS; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ alpha chain; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ beta chain; Flags: Precursor gi|550326901|gb|ERP54763.1| arginine biosynthesis protein ArgJ [Populus trichocarpa] Length = 481 Score = 53.1 bits (126), Expect(2) = 2e-07 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAGI F N L I LG+IL MD GQPL FDR Sbjct: 390 PNWGRIAAAAGYAGIPFHQNNLRIMLGDILLMDNGQPLSFDR 431 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 383 AAVYGRDPNW 392 >ref|XP_002332319.1| predicted protein [Populus trichocarpa] Length = 481 Score = 53.1 bits (126), Expect(2) = 2e-07 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAGI F N L I LG+IL MD GQPL FDR Sbjct: 390 PNWGRIAAAAGYAGIPFHQNNLRIMLGDILLMDNGQPLSFDR 431 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 383 AAVYGRDPNW 392 >ref|XP_002531335.1| arginine biosynthesis protein argJ 1, putative [Ricinus communis] gi|306531013|sp|B9SZB6.1|ARGJ_RICCO RecName: Full=Arginine biosynthesis bifunctional protein ArgJ, chloroplastic; Includes: RecName: Full=Glutamate N-acetyltransferase; Short=GAT; AltName: Full=Ornithine acetyltransferase; Short=OATase; AltName: Full=Ornithine transacetylase; Includes: RecName: Full=Amino-acid acetyltransferase; AltName: Full=N-acetylglutamate synthase; Short=AGS; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ alpha chain; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ beta chain; Flags: Precursor gi|223529057|gb|EEF31042.1| arginine biosynthesis protein argJ 1, putative [Ricinus communis] Length = 469 Score = 53.1 bits (126), Expect(2) = 2e-07 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAGI F N L I LG+IL MD GQPL FDR Sbjct: 378 PNWGRIAAAAGYAGIPFHQNKLRILLGDILLMDNGQPLAFDR 419 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 371 AAVYGRDPNW 380 >ref|YP_008900063.1| bifunctional ornithine acetyltransferase / N-acetylglutamate synthase protein ArgJ [Thermosynechococcus sp. NK55] gi|571030148|ref|WP_024124945.1| bifunctional ornithine acetyltransferase / N-acetylglutamate synthase protein ArgJ [Thermosynechococcus sp. NK55] gi|564738152|gb|AHB88550.1| bifunctional ornithine acetyltransferase / N-acetylglutamate synthase protein ArgJ [Thermosynechococcus sp. NK55] Length = 419 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAG+ FD + L ISLG I M +GQPLPFDR Sbjct: 318 PNWGRIAAAAGYAGVPFDASNLAISLGGIAMMRQGQPLPFDR 359 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 +A+YGRDPNW Sbjct: 311 SAIYGRDPNW 320 >ref|XP_006480793.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X1 [Citrus sinensis] Length = 471 Score = 52.4 bits (124), Expect(2) = 3e-07 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAG+ F N L I LG+ L MD GQPLPFDR Sbjct: 380 PNWGRIAAAAGYAGVSFYQNKLRILLGDSLLMDGGQPLPFDR 421 Score = 27.7 bits (60), Expect(2) = 3e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 373 AAVYGRDPNW 382 >ref|XP_006429063.1| hypothetical protein CICLE_v10011653mg [Citrus clementina] gi|557531120|gb|ESR42303.1| hypothetical protein CICLE_v10011653mg [Citrus clementina] Length = 471 Score = 52.4 bits (124), Expect(2) = 3e-07 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAG+ F N L I LG+ L MD GQPLPFDR Sbjct: 380 PNWGRIAAAAGYAGVSFYQNKLRILLGDSLLMDGGQPLPFDR 421 Score = 27.7 bits (60), Expect(2) = 3e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 373 AAVYGRDPNW 382 >ref|XP_006480794.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X2 [Citrus sinensis] Length = 462 Score = 52.4 bits (124), Expect(2) = 3e-07 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAG+ F N L I LG+ L MD GQPLPFDR Sbjct: 380 PNWGRIAAAAGYAGVSFYQNKLRILLGDSLLMDGGQPLPFDR 421 Score = 27.7 bits (60), Expect(2) = 3e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 373 AAVYGRDPNW 382 >ref|XP_006429062.1| hypothetical protein CICLE_v10011653mg [Citrus clementina] gi|557531119|gb|ESR42302.1| hypothetical protein CICLE_v10011653mg [Citrus clementina] Length = 462 Score = 52.4 bits (124), Expect(2) = 3e-07 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAG+ F N L I LG+ L MD GQPLPFDR Sbjct: 380 PNWGRIAAAAGYAGVSFYQNKLRILLGDSLLMDGGQPLPFDR 421 Score = 27.7 bits (60), Expect(2) = 3e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 373 AAVYGRDPNW 382 >ref|XP_006429061.1| hypothetical protein CICLE_v10011653mg [Citrus clementina] gi|557531118|gb|ESR42301.1| hypothetical protein CICLE_v10011653mg [Citrus clementina] Length = 421 Score = 52.4 bits (124), Expect(2) = 3e-07 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAG+ F N L I LG+ L MD GQPLPFDR Sbjct: 380 PNWGRIAAAAGYAGVSFYQNKLRILLGDSLLMDGGQPLPFDR 421 Score = 27.7 bits (60), Expect(2) = 3e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 373 AAVYGRDPNW 382 >ref|XP_002881511.1| arginine biosynthesis protein ArgJ family [Arabidopsis lyrata subsp. lyrata] gi|297327350|gb|EFH57770.1| arginine biosynthesis protein ArgJ family [Arabidopsis lyrata subsp. lyrata] Length = 468 Score = 51.2 bits (121), Expect(2) = 6e-07 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR+++ AGYAG+ F + L ISLG+ M+ GQPLPFDR Sbjct: 377 PNWGRIAAAAGYAGVSFQMDKLKISLGDFSLMESGQPLPFDR 418 Score = 27.7 bits (60), Expect(2) = 6e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYGRDPNW Sbjct: 370 AAVYGRDPNW 379 >ref|XP_004984760.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Setaria italica] Length = 464 Score = 52.8 bits (125), Expect(2) = 6e-07 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDR 260 P GR++ GY+GIQFD N L ISLG I M GQPLPFDR Sbjct: 373 PNWGRIACSVGYSGIQFDANRLDISLGAIPLMKNGQPLPFDR 414 Score = 26.2 bits (56), Expect(2) = 6e-07 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAV+GRDPNW Sbjct: 366 AAVFGRDPNW 375 >ref|XP_005645647.1| putative arginine biosynthesis bifunctional protein argJ 1 [Coccomyxa subellipsoidea C-169] gi|384247617|gb|EIE21103.1| putative arginine biosynthesis bifunctional protein argJ 1 [Coccomyxa subellipsoidea C-169] Length = 428 Score = 53.1 bits (126), Expect(2) = 6e-07 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = -2 Query: 385 PKLGRLSSVAGYAGIQFDPNML*ISLGNILPMDEGQPLPFDRKKILLFCTQS 230 P GR++ AGYAG+ +DPN L I LG+I M+ GQPL FD K + T + Sbjct: 337 PNWGRIACAAGYAGVPYDPNELNIQLGDIPLMEAGQPLAFDAKAASAYLTST 388 Score = 25.8 bits (55), Expect(2) = 6e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 405 AAVYGRDPNW 376 AAVYG DPNW Sbjct: 330 AAVYGHDPNW 339