BLASTX nr result
ID: Catharanthus23_contig00028420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00028420 (407 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63121.1| AT-hook DNA-binding protein [Catharanthus roseus] 75 9e-12 >gb|ABL63121.1| AT-hook DNA-binding protein [Catharanthus roseus] Length = 302 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/42 (83%), Positives = 35/42 (83%) Frame = -1 Query: 344 SQSHGMADDPVSPNFYSLPPNLVPNGQEVFWTXXXXXXXPSY 219 SQSHGMADDPVSPNFYSLPPNLVPNGQEVFWT PSY Sbjct: 261 SQSHGMADDPVSPNFYSLPPNLVPNGQEVFWTPPPRPPPPSY 302