BLASTX nr result
ID: Catharanthus23_contig00028236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00028236 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004240634.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_006364563.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-14 gb|EXB82495.1| hypothetical protein L484_027670 [Morus notabilis] 80 3e-13 ref|XP_002530052.1| pentatricopeptide repeat-containing protein,... 80 3e-13 gb|EMJ28460.1| hypothetical protein PRUPE_ppa017811mg [Prunus pe... 80 4e-13 ref|XP_002282301.1| PREDICTED: pentatricopeptide repeat-containi... 79 8e-13 ref|XP_006483972.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 ref|XP_006438222.1| hypothetical protein CICLE_v10031251mg [Citr... 75 7e-12 ref|XP_002312667.1| pentatricopeptide repeat-containing family p... 75 1e-11 gb|EOY00680.1| Pentatricopeptide repeat superfamily protein isof... 74 2e-11 ref|XP_004310156.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_004135492.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_003531325.2| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 gb|ESW31683.1| hypothetical protein PHAVU_002G258900g [Phaseolus... 69 5e-10 ref|NP_172763.1| pentatricopeptide repeat-containing protein [Ar... 65 1e-08 ref|XP_002889980.1| pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_006304861.1| hypothetical protein CARUB_v10012598mg [Caps... 63 4e-08 ref|XP_006417164.1| hypothetical protein EUTSA_v10007381mg [Eutr... 62 6e-08 ref|XP_004504137.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_002461240.1| hypothetical protein SORBIDRAFT_02g043430 [S... 56 4e-06 >ref|XP_004240634.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Solanum lycopersicum] Length = 511 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MYKALGKHRLIYR I+ V+TG + +A+QVFDEMTQSDCRVFSIDYNR IG Sbjct: 1 MYKALGKHRLIYRTRISSYVKTGLVNEALQVFDEMTQSDCRVFSIDYNRIIG 52 >ref|XP_006364563.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 511 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MYKALGKHRLIYR I+ V+TG + +A+QVFD+MTQSDCRVFSIDYNR IG Sbjct: 1 MYKALGKHRLIYRTRISNYVKTGLVNEALQVFDKMTQSDCRVFSIDYNRIIG 52 >gb|EXB82495.1| hypothetical protein L484_027670 [Morus notabilis] Length = 513 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 M +LG HRL+YR+ IA CV+TG I+ A+Q+FDEM+ SDCRVFS+DYNRFIG Sbjct: 1 MIHSLGAHRLLYRSRIAYCVKTGLIDHAVQLFDEMSHSDCRVFSVDYNRFIG 52 >ref|XP_002530052.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530468|gb|EEF32352.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 554 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY++LG HRLIYR+ IA V+ G I++A+QVFDEM+QS+CRVFSIDYNRFIG Sbjct: 1 MYQSLGAHRLIYRSRIAGYVKAGLIDKAVQVFDEMSQSNCRVFSIDYNRFIG 52 >gb|EMJ28460.1| hypothetical protein PRUPE_ppa017811mg [Prunus persica] Length = 541 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY++LG +RLI+R+ I V+TG I+QA+QVFDEMT+SDCRVFSIDYNRFIG Sbjct: 1 MYRSLGVNRLIFRSRIVYYVKTGLIDQALQVFDEMTRSDCRVFSIDYNRFIG 52 >ref|XP_002282301.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Vitis vinifera] gi|296081374|emb|CBI16807.3| unnamed protein product [Vitis vinifera] Length = 519 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/52 (67%), Positives = 45/52 (86%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY++LG+HRL YRA I+ V+ G I+QA++ FDEMT+S+CRVFSIDYNRFIG Sbjct: 1 MYRSLGRHRLAYRAQISSYVKAGLIDQALKTFDEMTKSNCRVFSIDYNRFIG 52 >ref|XP_006483972.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X1 [Citrus sinensis] gi|568860947|ref|XP_006483973.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X2 [Citrus sinensis] Length = 517 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 M + LG RLIYRA I+ V+ G I+QA+ VFDEMTQS+CRVFSIDYNRFIG Sbjct: 1 MIQKLGAQRLIYRAQISNLVKAGLIDQAVHVFDEMTQSNCRVFSIDYNRFIG 52 >ref|XP_006438222.1| hypothetical protein CICLE_v10031251mg [Citrus clementina] gi|557540418|gb|ESR51462.1| hypothetical protein CICLE_v10031251mg [Citrus clementina] Length = 517 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 M + LG RLIYRA I+ V+ G I+QA+ VFDEMTQS+CRVFSIDYNRFIG Sbjct: 1 MIQKLGAQRLIYRAQISNLVKAGLIDQAVHVFDEMTQSNCRVFSIDYNRFIG 52 >ref|XP_002312667.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222852487|gb|EEE90034.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 512 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY+ LG HRLIYR IA V+ G I+ A++VFDEMT S+CRVF IDYNRFIG Sbjct: 1 MYQPLGVHRLIYRTRIASYVKAGLIDYAVKVFDEMTLSECRVFGIDYNRFIG 52 >gb|EOY00680.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508708784|gb|EOY00681.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508708785|gb|EOY00682.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508708786|gb|EOY00683.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 516 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY ALG RLIYRA I++ V+ G QAI +FD+MTQSDCRVF +DYNRFIG Sbjct: 1 MYHALGAPRLIYRAHISRLVKNGLTNQAISMFDQMTQSDCRVFGLDYNRFIG 52 >ref|XP_004310156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 516 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = +1 Query: 181 YKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 + LG HRLIYR+ + V+TG I+ A+ VFDEMTQS+CRVFS+DYNRFIG Sbjct: 3 HTTLGAHRLIYRSRMTHYVKTGLIDHALHVFDEMTQSNCRVFSVDYNRFIG 53 >ref|XP_004135492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Cucumis sativus] gi|449494962|ref|XP_004159696.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Cucumis sativus] Length = 514 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY LG +RL++RA I +CV+ G I++AI++FDEMTQSDC V S DYNRFIG Sbjct: 1 MYHRLGANRLVFRASITKCVKVGLIDEAIRIFDEMTQSDCPVTSRDYNRFIG 52 >ref|XP_003531325.2| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X1 [Glycine max] gi|571471241|ref|XP_006585252.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X2 [Glycine max] Length = 521 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = +1 Query: 178 MYKA-LGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY++ +G HRL YR+ I++ V+ G I QAI +FD+MT+S+CRVFS+DYNRFIG Sbjct: 1 MYQSSIGAHRLAYRSQISKLVKAGLINQAIYLFDQMTESNCRVFSVDYNRFIG 53 >gb|ESW31683.1| hypothetical protein PHAVU_002G258900g [Phaseolus vulgaris] Length = 518 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = +1 Query: 178 MYKA-LGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY++ +G HRL YR+ I++ V+ G I AI +FD+MTQS+CRVFS+DYNRFIG Sbjct: 1 MYQSSIGAHRLAYRSHISKLVKAGLINHAIHLFDQMTQSNCRVFSVDYNRFIG 53 >ref|NP_172763.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200670|sp|Q9SAD9.1|PPR40_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g13040, mitochondrial; Flags: Precursor gi|4850387|gb|AAD31057.1|AC007357_6 F3F19.6 [Arabidopsis thaliana] gi|332190841|gb|AEE28962.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 517 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 M++ LG RL YR+ IA V++G I+ A+QVFDEM S RVFS DYNRFIG Sbjct: 1 MHQTLGAVRLAYRSRIANLVKSGMIDNAVQVFDEMRHSSYRVFSFDYNRFIG 52 >ref|XP_002889980.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335822|gb|EFH66239.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 517 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 M++ LG RL YR+ IA V++G I+ A+QVFDEM S RVFS DYNRFIG Sbjct: 1 MHQTLGAVRLAYRSRIANLVKSGMIDNAVQVFDEMRHSSYRVFSSDYNRFIG 52 >ref|XP_006304861.1| hypothetical protein CARUB_v10012598mg [Capsella rubella] gi|482573572|gb|EOA37759.1| hypothetical protein CARUB_v10012598mg [Capsella rubella] Length = 517 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 M++ LG RL YR+ IA+ V++G I+ A+QVFDEM S RVFS DYNRFIG Sbjct: 1 MHQTLGAVRLAYRSRIAKLVKSGIIDNAVQVFDEMRHSSYRVFSSDYNRFIG 52 >ref|XP_006417164.1| hypothetical protein EUTSA_v10007381mg [Eutrema salsugineum] gi|557094935|gb|ESQ35517.1| hypothetical protein EUTSA_v10007381mg [Eutrema salsugineum] Length = 517 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 M++ LG RL YR+ IA V++G I+ A+QVFDE+ S RVFS DYNRFIG Sbjct: 1 MHQTLGAVRLAYRSRIAYLVKSGMIDNAVQVFDELRHSSFRVFSSDYNRFIG 52 >ref|XP_004504137.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Cicer arietinum] Length = 516 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = +1 Query: 178 MYKALGKHRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 MY ++ RL+YR+ I+ V+ G I+ AI++FDEM+Q++ R FSIDYNRFIG Sbjct: 1 MYHSVAARRLLYRSQISYYVKAGLIDTAIKLFDEMSQTNSRPFSIDYNRFIG 52 >ref|XP_002461240.1| hypothetical protein SORBIDRAFT_02g043430 [Sorghum bicolor] gi|241924617|gb|EER97761.1| hypothetical protein SORBIDRAFT_02g043430 [Sorghum bicolor] Length = 551 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +1 Query: 199 HRLIYRACIAQCVRTGQIEQAIQVFDEMTQSDCRVFSIDYNRFIG 333 HR +YR ++ VR G+ + IQ FDEM S CR F +DYNRFIG Sbjct: 162 HRSLYRILLSGYVRAGKFDSVIQTFDEMVTSGCREFGVDYNRFIG 206