BLASTX nr result
ID: Catharanthus23_contig00027675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00027675 (531 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC25101.1| putative transposase [Arabidopsis thaliana] 50 5e-10 >gb|AAC25101.1| putative transposase [Arabidopsis thaliana] Length = 729 Score = 50.4 bits (119), Expect(2) = 5e-10 Identities = 28/73 (38%), Positives = 40/73 (54%), Gaps = 3/73 (4%) Frame = +1 Query: 7 EESITSGQNCRQRKDIT*KYCTQIADPQNNNKVLRCDLTIS---GEGINRMKQHIAGVKG 177 E+ + ++ R + DI Y Q D + VL C G GINRMK H+AGVKG Sbjct: 10 EDIAAANRSIRGKSDIAWSYVIQSKD-EKGKTVLECAFCHKKKRGGGINRMKHHLAGVKG 68 Query: 178 NISSCKKVSSEIQ 216 N +C K+S++I+ Sbjct: 69 NTDACLKISADIR 81 Score = 38.9 bits (89), Expect(2) = 5e-10 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 332 PRKDKGKGIQINEGLNKGKKRGSQGIDA--YMTSKAYDSSQPSIKASLQSKEKWH 490 P + G I + +KR QGID Y +D +QPSIKA +QSKE+ H Sbjct: 109 PEIEDVDGDDIRVDVRPSQKRKKQGIDLHDYFKRGVHDQTQPSIKACMQSKERIH 163