BLASTX nr result
ID: Catharanthus23_contig00027464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00027464 (355 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006345691.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 >ref|XP_006345691.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like [Solanum tuberosum] Length = 483 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/97 (31%), Positives = 57/97 (58%), Gaps = 1/97 (1%) Frame = +3 Query: 63 NSLPFNSAVQSSKPFSALQELGQSAKTIQFKGKRVLDIVASKPNVANNCQSHLRLVQDFL 242 N+L F ++ + P + ++ KG+R LDI+A K NV N Q+ ++L++DFL Sbjct: 2 NNLLFRYGMRKNLPLTKIKR--------PLKGQRFLDILAPKQNVIKNHQNCVKLIEDFL 53 Query: 243 RTNPIQLKETQIDNE-TFHPDQNENSISILYKLHKRG 350 +T +Q + +D + +F + E+S+S+L++ HK G Sbjct: 54 QTGSVQNCKHPLDKDNSFSYSKEEDSVSLLFRFHKEG 90