BLASTX nr result
ID: Catharanthus23_contig00027244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00027244 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303119.1| hypothetical protein POPTR_0002s26020g [Popu... 58 1e-06 ref|XP_006386917.1| hypothetical protein POPTR_0002s26020g [Popu... 56 4e-06 >ref|XP_002303119.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa] gi|222844845|gb|EEE82392.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa] Length = 983 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/65 (49%), Positives = 39/65 (60%) Frame = +3 Query: 6 SPDEKPIIGTVGSYWRHTGQAVDEFSGSSYGQISNEPMSGQCRNGRMKSPSTTVQTRLEK 185 SPDE PIIGTVG+YW H G D S SSY I N S + R+ ST +TRLE+ Sbjct: 366 SPDEMPIIGTVGTYWNHGGSGKDSGSASSYKGIPN-TTSKYREDKRVNWHSTPFETRLER 424 Query: 186 AMDSV 200 A++ V Sbjct: 425 ALNGV 429 >ref|XP_006386917.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa] gi|550345841|gb|ERP64714.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa] Length = 442 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/63 (49%), Positives = 38/63 (60%) Frame = +3 Query: 6 SPDEKPIIGTVGSYWRHTGQAVDEFSGSSYGQISNEPMSGQCRNGRMKSPSTTVQTRLEK 185 SPDE PIIGTVG+YW H G D S SSY I N S + R+ ST +TRLE+ Sbjct: 366 SPDEMPIIGTVGTYWNHGGSGKDSGSASSYKGIPN-TTSKYREDKRVNWHSTPFETRLER 424 Query: 186 AMD 194 A++ Sbjct: 425 ALN 427