BLASTX nr result
ID: Catharanthus23_contig00025453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00025453 (300 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56319.1| hypothetical protein L484_024861 [Morus notabilis] 62 6e-08 gb|EXB55017.1| hypothetical protein L484_007348 [Morus notabilis] 58 1e-06 ref|XP_002510688.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_002307798.1| hypothetical protein POPTR_0005s27380g [Popu... 57 2e-06 >gb|EXB56319.1| hypothetical protein L484_024861 [Morus notabilis] Length = 320 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = +1 Query: 1 SRPHAYSEEDIFNQLVAIGIESEIIDDCYLYLAQNTNKTRAFFGCPSERCKSILMKLM 174 SRPH YSE+++F +LV IGIE ++ Y +L N + RAFFGCP K L+++M Sbjct: 257 SRPHVYSEQEVFRELVNIGIEKQLRFRAYTFLIANARRVRAFFGCPVGERKEFLLQMM 314 >gb|EXB55017.1| hypothetical protein L484_007348 [Morus notabilis] Length = 160 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/58 (43%), Positives = 38/58 (65%) Frame = +1 Query: 1 SRPHAYSEEDIFNQLVAIGIESEIIDDCYLYLAQNTNKTRAFFGCPSERCKSILMKLM 174 SR YSEE++F +LV IG++ + Y +L Q+ + RAFFGCP E K+ +++LM Sbjct: 97 SRARVYSEEEVFAELVNIGVDERLRYKAYTFLTQDATRVRAFFGCPVEERKNFVLQLM 154 >ref|XP_002510688.1| conserved hypothetical protein [Ricinus communis] gi|223551389|gb|EEF52875.1| conserved hypothetical protein [Ricinus communis] Length = 321 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/57 (43%), Positives = 36/57 (63%) Frame = +1 Query: 4 RPHAYSEEDIFNQLVAIGIESEIIDDCYLYLAQNTNKTRAFFGCPSERCKSILMKLM 174 R YSE+++F +LV IG+E + Y +L N + RAFFGCPSE K L+++M Sbjct: 259 RLRVYSEQEVFTELVKIGVERHMRYKAYTFLIANAGRARAFFGCPSEERKEFLLQMM 315 >ref|XP_002307798.1| hypothetical protein POPTR_0005s27380g [Populus trichocarpa] gi|222857247|gb|EEE94794.1| hypothetical protein POPTR_0005s27380g [Populus trichocarpa] Length = 322 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/57 (40%), Positives = 37/57 (64%) Frame = +1 Query: 4 RPHAYSEEDIFNQLVAIGIESEIIDDCYLYLAQNTNKTRAFFGCPSERCKSILMKLM 174 RP YSE+++F++LV IG+E+ + Y +L N+ + RAFFGCP + L+ +M Sbjct: 256 RPRVYSEQEVFSELVKIGVETHLRYKAYTFLVANSGRVRAFFGCPPGERREFLLHMM 312