BLASTX nr result
ID: Catharanthus23_contig00024914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00024914 (429 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307034.1| PREDICTED: 54S ribosomal protein L51, mitoch... 54 6e-12 ref|XP_004307035.1| PREDICTED: 54S ribosomal protein L51, mitoch... 54 7e-12 ref|XP_002465669.1| hypothetical protein SORBIDRAFT_01g043440 [S... 52 5e-11 ref|XP_002438166.1| hypothetical protein SORBIDRAFT_10g009060 [S... 52 5e-11 ref|NP_001148774.1| LOC100282391 [Zea mays] gi|195622062|gb|ACG3... 52 5e-11 ref|NP_001130710.1| hypothetical protein [Zea mays] gi|194689906... 52 5e-11 tpg|DAA43879.1| TPA: hypothetical protein ZEAMMB73_621483 [Zea m... 52 6e-11 ref|NP_001173310.1| Os03g0207250 [Oryza sativa Japonica Group] g... 51 7e-11 ref|NP_001190137.1| mitochondrial ribosomal protein L51/S25/CI-B... 52 9e-11 ref|NP_191524.1| mitochondrial ribosomal protein L51/S25/CI-B8 f... 52 9e-11 ref|XP_002876517.1| mitochondrial ribosomal protein L51/S25/CI-B... 52 9e-11 gb|EMJ27055.1| hypothetical protein PRUPE_ppa013515mg [Prunus pe... 50 9e-11 ref|XP_006649598.1| PREDICTED: 54S ribosomal protein L51, mitoch... 50 1e-10 ref|XP_004510556.1| PREDICTED: 54S ribosomal protein L51, mitoch... 50 2e-10 gb|AFK38190.1| unknown [Medicago truncatula] 50 2e-10 ref|XP_003627415.1| Mitochondrial ribosomal protein L43 [Medicag... 50 2e-10 ref|XP_004985267.1| PREDICTED: 54S ribosomal protein L51, mitoch... 50 3e-10 ref|XP_002330707.1| predicted protein [Populus trichocarpa] 50 3e-10 gb|ACG40225.1| mitochondrial ribosomal protein L43 [Zea mays] 49 3e-10 gb|EOY04682.1| Mitochondrial ribosomal protein L51/S25/CI-B8 fam... 49 3e-10 >ref|XP_004307034.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 1 [Fragaria vesca subsp. vesca] Length = 124 Score = 54.3 bits (129), Expect(2) = 6e-12 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCVK++ EE+L C+T+LRNSLGRKVVKL T Sbjct: 72 ERVVCVKNMDPEEVLQCATRLRNSLGRKVVKLRT 105 Score = 41.6 bits (96), Expect(2) = 6e-12 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT++K Sbjct: 106 RHVTKHPSVQGTWTTDIK 123 >ref|XP_004307035.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 2 [Fragaria vesca subsp. vesca] gi|470142691|ref|XP_004307036.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 3 [Fragaria vesca subsp. vesca] gi|470142693|ref|XP_004307037.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 4 [Fragaria vesca subsp. vesca] Length = 119 Score = 54.3 bits (129), Expect(2) = 7e-12 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCVK++ EE+L C+T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVKNMDPEEVLQCATRLRNSLGRKVVKLRT 100 Score = 41.6 bits (96), Expect(2) = 7e-12 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT++K Sbjct: 101 RHVTKHPSVQGTWTTDIK 118 >ref|XP_002465669.1| hypothetical protein SORBIDRAFT_01g043440 [Sorghum bicolor] gi|241919523|gb|EER92667.1| hypothetical protein SORBIDRAFT_01g043440 [Sorghum bicolor] Length = 119 Score = 51.6 bits (122), Expect(2) = 5e-11 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L EEILL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRT 100 Score = 41.2 bits (95), Expect(2) = 5e-11 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTTELK+ Sbjct: 101 RHVTKRPSVQGTWTTELKM 119 >ref|XP_002438166.1| hypothetical protein SORBIDRAFT_10g009060 [Sorghum bicolor] gi|241916389|gb|EER89533.1| hypothetical protein SORBIDRAFT_10g009060 [Sorghum bicolor] gi|414865320|tpg|DAA43877.1| TPA: ribosomal protein L43 isoform 1 [Zea mays] gi|414865321|tpg|DAA43878.1| TPA: ribosomal protein L43 isoform 2 [Zea mays] Length = 119 Score = 51.6 bits (122), Expect(2) = 5e-11 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L EEILL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRT 100 Score = 41.2 bits (95), Expect(2) = 5e-11 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTTELK+ Sbjct: 101 RHVTKRPSVQGTWTTELKM 119 >ref|NP_001148774.1| LOC100282391 [Zea mays] gi|195622062|gb|ACG32861.1| mitochondrial ribosomal protein L43 [Zea mays] Length = 119 Score = 51.6 bits (122), Expect(2) = 5e-11 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L EEILL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVRNLPPEEILLQATKLRNSLGRKVVKLRT 100 Score = 41.2 bits (95), Expect(2) = 5e-11 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTTELK+ Sbjct: 101 RHVTKRPSVQGTWTTELKM 119 >ref|NP_001130710.1| hypothetical protein [Zea mays] gi|194689906|gb|ACF79037.1| unknown [Zea mays] gi|413956633|gb|AFW89282.1| hypothetical protein ZEAMMB73_180611 [Zea mays] Length = 119 Score = 51.6 bits (122), Expect(2) = 5e-11 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L EEILL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRT 100 Score = 41.2 bits (95), Expect(2) = 5e-11 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTTELK+ Sbjct: 101 RHVTKRPSVQGTWTTELKM 119 >tpg|DAA43879.1| TPA: hypothetical protein ZEAMMB73_621483 [Zea mays] Length = 90 Score = 51.6 bits (122), Expect(2) = 6e-11 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L EEILL +T+LRNSLGRKVVKL T Sbjct: 38 ERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRT 71 Score = 41.2 bits (95), Expect(2) = 6e-11 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTTELK+ Sbjct: 72 RHVTKRPSVQGTWTTELKM 90 >ref|NP_001173310.1| Os03g0207250 [Oryza sativa Japonica Group] gi|26006491|gb|AAN77300.1| Unknown protein [Oryza sativa Japonica Group] gi|108706764|gb|ABF94559.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein, putative, expressed [Oryza sativa Japonica Group] gi|108706765|gb|ABF94560.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein, putative, expressed [Oryza sativa Japonica Group] gi|125542835|gb|EAY88974.1| hypothetical protein OsI_10460 [Oryza sativa Indica Group] gi|125585334|gb|EAZ25998.1| hypothetical protein OsJ_09851 [Oryza sativa Japonica Group] gi|215768870|dbj|BAH01099.1| unnamed protein product [Oryza sativa Japonica Group] gi|255674301|dbj|BAH92038.1| Os03g0207250 [Oryza sativa Japonica Group] Length = 119 Score = 51.2 bits (121), Expect(2) = 7e-11 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L+ E+ILL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVRNLAPEDILLQATRLRNSLGRKVVKLRT 100 Score = 41.2 bits (95), Expect(2) = 7e-11 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTTELK+ Sbjct: 101 RHVTKRPSVQGTWTTELKM 119 >ref|NP_001190137.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] gi|332646430|gb|AEE79951.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] Length = 146 Score = 52.0 bits (123), Expect(2) = 9e-11 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCVK++ EE+LL +T+LRNSLGRKVVKL T Sbjct: 94 ERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRT 127 Score = 40.0 bits (92), Expect(2) = 9e-11 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT +K Sbjct: 128 RHVTKHPSVQGTWTTAVK 145 >ref|NP_191524.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] gi|6996301|emb|CAB75462.1| putative protein [Arabidopsis thaliana] gi|21617971|gb|AAM67021.1| unknown [Arabidopsis thaliana] gi|27808540|gb|AAO24550.1| At3g59650 [Arabidopsis thaliana] gi|110743592|dbj|BAE99633.1| hypothetical protein [Arabidopsis thaliana] gi|332646429|gb|AEE79950.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] Length = 119 Score = 52.0 bits (123), Expect(2) = 9e-11 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCVK++ EE+LL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRT 100 Score = 40.0 bits (92), Expect(2) = 9e-11 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT +K Sbjct: 101 RHVTKHPSVQGTWTTAVK 118 >ref|XP_002876517.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis lyrata subsp. lyrata] gi|565468360|ref|XP_006292060.1| hypothetical protein CARUB_v10018255mg [Capsella rubella] gi|297322355|gb|EFH52776.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis lyrata subsp. lyrata] gi|482560767|gb|EOA24958.1| hypothetical protein CARUB_v10018255mg [Capsella rubella] Length = 119 Score = 52.0 bits (123), Expect(2) = 9e-11 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCVK++ EE+LL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRT 100 Score = 40.0 bits (92), Expect(2) = 9e-11 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT +K Sbjct: 101 RHVTKHPSVQGTWTTAVK 118 >gb|EMJ27055.1| hypothetical protein PRUPE_ppa013515mg [Prunus persica] Length = 119 Score = 50.4 bits (119), Expect(2) = 9e-11 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCVK++ EE+L +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVKNMDPEEVLQYATRLRNSLGRKVVKLKT 100 Score = 41.6 bits (96), Expect(2) = 9e-11 Identities = 16/21 (76%), Positives = 20/21 (95%) Frame = -3 Query: 337 IEYRHVTKHPSVQGTWTTELK 275 ++ RHVTKHPSVQGTWTT++K Sbjct: 98 LKTRHVTKHPSVQGTWTTDVK 118 >ref|XP_006649598.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Oryza brachyantha] Length = 119 Score = 50.4 bits (119), Expect(2) = 1e-10 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L E+ILL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVRNLPPEDILLQATRLRNSLGRKVVKLRT 100 Score = 41.2 bits (95), Expect(2) = 1e-10 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTTELK+ Sbjct: 101 RHVTKRPSVQGTWTTELKM 119 >ref|XP_004510556.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Cicer arietinum] Length = 119 Score = 50.1 bits (118), Expect(2) = 2e-10 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV+++ +EE+LL +T+LRN+LGRKV+KL T Sbjct: 67 ERVVCVRNMDAEEVLLHATRLRNALGRKVIKLRT 100 Score = 41.2 bits (95), Expect(2) = 2e-10 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT LK Sbjct: 101 RHVTKHPSVQGTWTTALK 118 >gb|AFK38190.1| unknown [Medicago truncatula] Length = 119 Score = 49.7 bits (117), Expect(2) = 2e-10 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 +RVVCVK++ EEILL +T+LRN+LGRKV+KL T Sbjct: 67 DRVVCVKNMDPEEILLHATRLRNALGRKVIKLRT 100 Score = 41.2 bits (95), Expect(2) = 2e-10 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT LK Sbjct: 101 RHVTKHPSVQGTWTTALK 118 >ref|XP_003627415.1| Mitochondrial ribosomal protein L43 [Medicago truncatula] gi|355521437|gb|AET01891.1| Mitochondrial ribosomal protein L43 [Medicago truncatula] Length = 119 Score = 49.7 bits (117), Expect(2) = 2e-10 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 +RVVCVK++ EEILL +T+LRN+LGRKV+KL T Sbjct: 67 DRVVCVKNMDPEEILLHATRLRNALGRKVIKLRT 100 Score = 41.2 bits (95), Expect(2) = 2e-10 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT LK Sbjct: 101 RHVTKHPSVQGTWTTALK 118 >ref|XP_004985267.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Setaria italica] Length = 119 Score = 50.4 bits (119), Expect(2) = 3e-10 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L E+ILL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVRNLPPEDILLQATRLRNSLGRKVVKLRT 100 Score = 40.0 bits (92), Expect(2) = 3e-10 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTT+LK+ Sbjct: 101 RHVTKRPSVQGTWTTDLKM 119 >ref|XP_002330707.1| predicted protein [Populus trichocarpa] Length = 119 Score = 50.4 bits (119), Expect(2) = 3e-10 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCVK+L+SE++LL +T+LRN+LGRKV KL T Sbjct: 67 ERVVCVKNLASEDVLLHATRLRNALGRKVKKLPT 100 Score = 40.0 bits (92), Expect(2) = 3e-10 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELK 275 RHVTKHPSVQGTWTT+++ Sbjct: 101 RHVTKHPSVQGTWTTDVR 118 >gb|ACG40225.1| mitochondrial ribosomal protein L43 [Zea mays] Length = 119 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERVVCV++L EILL +T+LRNSLGRKVVKL T Sbjct: 67 ERVVCVRNLPPXEILLQATRLRNSLGRKVVKLRT 100 Score = 41.2 bits (95), Expect(2) = 3e-10 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 328 RHVTKHPSVQGTWTTELKL 272 RHVTK PSVQGTWTTELK+ Sbjct: 101 RHVTKRPSVQGTWTTELKM 119 >gb|EOY04682.1| Mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Theobroma cacao] Length = 119 Score = 48.9 bits (115), Expect(2) = 3e-10 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = -1 Query: 429 ERVVCVKSLSSEEILLCSTQLRNSLGRKVVKLST 328 ERV+CVK+++ E+ILL +++LRN+LGRKVVKL T Sbjct: 67 ERVICVKNMTPEDILLHASRLRNALGRKVVKLKT 100 Score = 41.6 bits (96), Expect(2) = 3e-10 Identities = 16/21 (76%), Positives = 20/21 (95%) Frame = -3 Query: 337 IEYRHVTKHPSVQGTWTTELK 275 ++ RHVTKHPSVQGTWTT++K Sbjct: 98 LKTRHVTKHPSVQGTWTTDVK 118