BLASTX nr result
ID: Catharanthus23_contig00024834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00024834 (765 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN34235.1| hypothetical protein [Cucumis melo subsp. melo] 63 1e-07 >gb|ADN34235.1| hypothetical protein [Cucumis melo subsp. melo] Length = 51 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 101 MCLTYVVAEVTNCKQADIDFRGHEEIYSESGGV 3 MCLTY+VAEVTNCKQA+ID R HEEIYSE GGV Sbjct: 1 MCLTYIVAEVTNCKQANIDIREHEEIYSEPGGV 33