BLASTX nr result
ID: Catharanthus23_contig00023319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00023319 (262 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38561.1| hypothetical protein L484_008589 [Morus notabilis] 60 2e-07 >gb|EXB38561.1| hypothetical protein L484_008589 [Morus notabilis] Length = 163 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +3 Query: 3 QFLENMGVFFGITAFFLDITIYFPLCLKVISWVTYFITLLAIILFSY 143 +FLE GVFF +T FF+ I+I FPLCL+V++WV Y I LL ++L +Y Sbjct: 114 RFLERAGVFFVVTGFFIVISIRFPLCLRVVTWVVYAIGLLVVLLCNY 160