BLASTX nr result
ID: Catharanthus23_contig00023300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00023300 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513588.1| WRKY transcription factor, putative [Ricinus... 60 3e-07 gb|AGQ04247.1| WRKY transcription factor 53 [Jatropha curcas] 59 5e-07 gb|ACV92029.1| WRKY transcription factor 27 [(Populus tomentosa ... 59 7e-07 ref|XP_002318373.1| hypothetical protein POPTR_0012s01380g [Popu... 59 7e-07 ref|XP_002267793.2| PREDICTED: probable WRKY transcription facto... 55 8e-06 >ref|XP_002513588.1| WRKY transcription factor, putative [Ricinus communis] gi|223547496|gb|EEF48991.1| WRKY transcription factor, putative [Ricinus communis] Length = 370 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 164 MESLNEMELKNLINELILGKELAKQLQIHLNAPTSSHETRELL 292 MES+ + E KNL+NEL +G+EL +QLQIHLN P+ S ETRELL Sbjct: 1 MESMGDCEQKNLVNELRMGRELTRQLQIHLNIPSYSRETRELL 43 >gb|AGQ04247.1| WRKY transcription factor 53 [Jatropha curcas] Length = 357 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +2 Query: 164 MESLNEMELKNLINELILGKELAKQLQIHLNAPTSSHETRELL 292 ME++ + E KNL+NEL G+ELA+QLQ+HLN P+SS E RE+L Sbjct: 1 MENMGDWEQKNLVNELTTGRELARQLQVHLNIPSSSREAREML 43 >gb|ACV92029.1| WRKY transcription factor 27 [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 372 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +2 Query: 164 MESLNEMELKNLINELILGKELAKQLQIHLNAPTSSHETRELL 292 M ++ + E KNL+ EL LG ELAKQLQIHLN P+SS ETRE+L Sbjct: 1 MANMGDWEQKNLVEELTLGMELAKQLQIHLNVPSSSRETREVL 43 >ref|XP_002318373.1| hypothetical protein POPTR_0012s01380g [Populus trichocarpa] gi|222859046|gb|EEE96593.1| hypothetical protein POPTR_0012s01380g [Populus trichocarpa] Length = 371 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +2 Query: 164 MESLNEMELKNLINELILGKELAKQLQIHLNAPTSSHETRELL 292 M ++ + E KNL+ EL LG ELAKQLQIHLN P+SS ETRE+L Sbjct: 1 MANMGDWEQKNLVEELTLGMELAKQLQIHLNVPSSSRETREVL 43 >ref|XP_002267793.2| PREDICTED: probable WRKY transcription factor 53-like [Vitis vinifera] gi|302143686|emb|CBI22547.3| unnamed protein product [Vitis vinifera] Length = 364 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 164 MESLNEMELKNLINELILGKELAKQLQIHLNAPTSSHETRELL 292 ME++ E KNLINEL G+ELAKQLQIHL+ +SSH+ RE L Sbjct: 1 MENMGSWEQKNLINELTNGRELAKQLQIHLSVSSSSHDARESL 43