BLASTX nr result
ID: Catharanthus23_contig00023249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00023249 (1432 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ19833.1| hypothetical protein PRUPE_ppa013665mg [Prunus pe... 50 8e-06 >gb|EMJ19833.1| hypothetical protein PRUPE_ppa013665mg [Prunus persica] Length = 110 Score = 49.7 bits (117), Expect(2) = 8e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -2 Query: 273 EMDHGRYGLQQGWENNSVIVVSFLITYM 190 EMD GRYGLQQGW+NNSVIVVS LI ++ Sbjct: 37 EMDPGRYGLQQGWDNNSVIVVSSLINHL 64 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 208 LLNHIYGMIYEKLGSCDCPFKPASHP*RIMRESHG 104 L+NH+YGM ++K + P R MRESHG Sbjct: 60 LINHLYGMNHDKYKNLLGPNLTVHFFGRKMRESHG 94