BLASTX nr result
ID: Catharanthus23_contig00023209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00023209 (222 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] 76 5e-12 gb|EOY31361.1| Pentatricopeptide repeat-containing protein isofo... 72 6e-11 gb|EOY31360.1| Pentatricopeptide repeat-containing protein isofo... 72 6e-11 ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 gb|EMJ26062.1| hypothetical protein PRUPE_ppa022809mg [Prunus pe... 64 3e-08 >emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] Length = 722 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = +2 Query: 2 DKLVAVYKGMKECGPYPNASTYNMLLNGMVSLGRLKDGIFFAKEMCSGGFVPSFT 166 D+LV VY GMK GPYPNAST+N+LL+GM S G L+ FFA+EM GF+PSFT Sbjct: 100 DELVQVYFGMKRLGPYPNASTFNILLDGMTSTGNLRAAFFFAEEMWRSGFLPSFT 154 >gb|EOY31361.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] Length = 720 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = +2 Query: 5 KLVAVYKGMKECGPYPNASTYNMLLNGMVSLGRLKDGIFFAKEMCSGGFVPSFT 166 +LV +Y GMK GP PNAST+N LLNGM+ LG LKD IF +EMC FVPSF+ Sbjct: 102 ELVEMYIGMKSFGPQPNASTFNTLLNGMLRLGNLKDAIFTVEEMCRNHFVPSFS 155 >gb|EOY31360.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 761 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = +2 Query: 5 KLVAVYKGMKECGPYPNASTYNMLLNGMVSLGRLKDGIFFAKEMCSGGFVPSFT 166 +LV +Y GMK GP PNAST+N LLNGM+ LG LKD IF +EMC FVPSF+ Sbjct: 102 ELVEMYIGMKSFGPQPNASTFNTLLNGMLRLGNLKDAIFTVEEMCRNHFVPSFS 155 >ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Vitis vinifera] Length = 629 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +2 Query: 29 MKECGPYPNASTYNMLLNGMVSLGRLKDGIFFAKEMCSGGFVPSFT 166 MK GPYPNAST+N+LL+GM S G L+ FFA+EM GF+PSFT Sbjct: 1 MKRLGPYPNASTFNILLDGMTSTGNLRAAFFFAEEMWRSGFLPSFT 46 >gb|EMJ26062.1| hypothetical protein PRUPE_ppa022809mg [Prunus persica] Length = 544 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +2 Query: 29 MKECGPYPNASTYNMLLNGMVSLGRLKDGIFFAKEMCSGGFVPSFT 166 M+ GP PN+ST+N+LLNGM+SLG LKD A++M GGF+PSFT Sbjct: 1 MERFGPTPNSSTFNVLLNGMLSLGHLKDAFVIAEKMVGGGFLPSFT 46