BLASTX nr result
ID: Catharanthus23_contig00021897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00021897 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62508.1| Putative F-box protein [Morus notabilis] 45 8e-07 >gb|EXB62508.1| Putative F-box protein [Morus notabilis] Length = 389 Score = 45.1 bits (105), Expect(2) = 8e-07 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 13/79 (16%) Frame = +1 Query: 1 YKIINSRSFIDSHLQRSETVITFREHARKDLD-------------AFSVQSKLFPFQSVL 141 Y +INS FID HL+RSETV+ F +K L A SV++KL+ S + Sbjct: 45 YNLINSTKFIDDHLRRSETVLLFLSSIQKKLSDSRMVSILPENPKAVSVEAKLYHANSAI 104 Query: 142 SLPRPILDQSSLCDIKLMK 198 + ++D++S I+ ++ Sbjct: 105 VFDKLLVDRASKFSIQFLE 123 Score = 33.5 bits (75), Expect(2) = 8e-07 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 195 EMTRGKIKIEEYKTTCMGKIRASCYG 272 E+ GK +I EY +C+G IRA+C G Sbjct: 123 ELKNGKCQIGEYNISCLGNIRATCNG 148