BLASTX nr result
ID: Catharanthus23_contig00021664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00021664 (268 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis] 61 2e-07 ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus... 59 5e-07 ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citr... 59 7e-07 ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer ... 57 2e-06 ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragar... 57 2e-06 ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanu... 57 2e-06 ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanu... 57 3e-06 ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Popu... 56 4e-06 ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragar... 55 7e-06 >gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis] Length = 509 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIP 129 +LHL+LGSLLH FDW +D S+ + D +R+GI VRK EPL+AIP Sbjct: 460 VLHLVLGSLLHHFDWELDASVDVETMDMKDRLGITVRKFEPLLAIP 505 >ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis] Length = 500 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIP 129 MLHLILGSLLH+FDW +D + D N+RMGI VRK EPLIA+P Sbjct: 454 MLHLILGSLLHQFDWELD---CKEKIDMNDRMGITVRKAEPLIAVP 496 >ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citrus clementina] gi|557532381|gb|ESR43564.1| hypothetical protein CICLE_v10013315mg [Citrus clementina] Length = 515 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIP 129 MLHLILGSLLH+FDW +D + D N+RMGI VRK EPLIA+P Sbjct: 469 MLHLILGSLLHQFDWELD---CKEEIDMNDRMGITVRKAEPLIAVP 511 >ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum] Length = 511 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIP 129 +LHL+LGSLLH+FDW +D ++ D +R+GI +RK +PL+A+P Sbjct: 461 VLHLVLGSLLHRFDWELDSNVTPSTIDMKDRLGITMRKFQPLLAVP 506 >ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca] Length = 517 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIP 129 MLHL LGSLLH+FDW + ++ D N+R+GI +RK +PL+A+P Sbjct: 462 MLHLTLGSLLHQFDWALGRNVTKDTMDWNDRLGITMRKYQPLLAVP 507 >ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum] Length = 507 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIPFPK 120 MLHL+LG+LL +FDW +D S+ + D +RMG+ VRK++PL AIP K Sbjct: 455 MLHLVLGALLSEFDWEIDVSVLDEALDTRDRMGVTVRKLKPLKAIPKTK 503 >ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum] Length = 507 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIP 129 MLH +LGSLLH+FDW + ++ K D ERMG+ VRK PL A+P Sbjct: 457 MLHFVLGSLLHEFDWELPSNVTPKSMDMKERMGMTVRKFNPLTAVP 502 >ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa] gi|222855083|gb|EEE92630.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa] Length = 508 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIP 129 +LHLILGSLLH FDW + ++ D +RMGI VRK EPL+A+P Sbjct: 457 VLHLILGSLLHHFDWEFEANVNPASVDKKDRMGITVRKSEPLMAVP 502 >ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca] Length = 512 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = -3 Query: 266 MLHLILGSLLHKFDWGVDESLAYKLKDDNERMGIVVRKMEPLIAIP 129 MLHL LGSLLH+FDW + +++ + + N+ +GI +RK EPL+A+P Sbjct: 462 MLHLTLGSLLHQFDWALGRNVSKESMNWNDNLGITMRKSEPLLAVP 507