BLASTX nr result
ID: Catharanthus23_contig00020254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00020254 (323 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535828.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis] gi|255608154|ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis] gi|223510119|gb|EEF23533.1| conserved hypothetical protein [Ricinus communis] gi|223521805|gb|EEF26555.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/46 (71%), Positives = 35/46 (76%), Gaps = 5/46 (10%) Frame = +1 Query: 1 STRLV*FRRKTVGSRWRHFFSP----SKGR-VELGRGFENRVGFCP 123 STR V FRRKTVGSRWR FF P +GR V+LGRGFENRVG CP Sbjct: 41 STRSVKFRRKTVGSRWRPFFGPLQKEMRGRGVKLGRGFENRVGSCP 86