BLASTX nr result
ID: Catharanthus23_contig00017920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00017920 (817 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera] 86 5e-20 gb|AAT39281.2| Integrase core domain containing protein [Solanum... 90 9e-20 dbj|BAM44531.1| polyprotein [Arabidopsis thaliana] 91 9e-20 dbj|BAM42646.1| polyprotein [Arabidopsis thaliana] 90 1e-19 gb|AAK43485.1|AC084807_10 polyprotein, putative [Arabidopsis tha... 87 1e-19 dbj|BAA78426.1| polyprotein [Arabidopsis thaliana] 90 1e-19 dbj|BAM44535.1| polyprotein [Arabidopsis thaliana] 90 1e-19 dbj|BAM44534.1| polyprotein [Arabidopsis thaliana] 90 1e-19 dbj|BAM42650.1| Polyprotein [Arabidopsis thaliana] 90 1e-19 dbj|BAM42649.1| Polyprotein [Arabidopsis thaliana] 90 1e-19 dbj|BAM42647.1| polyprotein [Arabidopsis thaliana] gi|403406144|... 90 1e-19 gb|AAK62788.1|AC027036_9 polyprotein, putative [Arabidopsis thal... 87 1e-19 dbj|BAK41511.1| polyprotein [Arabidopsis thaliana] 87 1e-19 gb|AAK62793.1|AC027036_14 polyprotein, putative [Arabidopsis tha... 87 1e-19 gb|AAC79110.1| putative polyprotein of LTR transposon [Arabidops... 90 1e-19 dbj|BAA78425.1| polyprotein [Arabidopsis thaliana] gi|338746551|... 87 1e-19 dbj|BAK41507.1| polyprotein [Arabidopsis thaliana] 87 1e-19 dbj|BAA78423.1| polyprotein [Arabidopsis thaliana] 87 1e-19 dbj|BAM44532.1| polyprotein [Arabidopsis thaliana] 90 1e-19 dbj|BAM44530.1| polyprotein [Arabidopsis thaliana] 90 1e-19 >emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera] Length = 1354 Score = 85.9 bits (211), Expect(2) = 5e-20 Identities = 39/66 (59%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 +RQ+DVNNAFLQG E V+M Q PGF + +PSY+C+L AIYGLKQ PRA Y+EL+ + Sbjct: 950 LRQLDVNNAFLQGRLSENVFMAQPPGFVDSDHPSYVCKLHKAIYGLKQAPRAWYHELRQF 1009 Query: 124 LLSMGY 107 LL+ G+ Sbjct: 1010 LLTSGF 1015 Score = 38.9 bits (89), Expect(2) = 5e-20 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGSS 4 D+SLF ++ S +YLLVY DDII+TGSS Sbjct: 1021 DTSLFVLRSSNHVVYLLVYVDDIILTGSS 1049 >gb|AAT39281.2| Integrase core domain containing protein [Solanum demissum] Length = 1760 Score = 89.7 bits (221), Expect(2) = 9e-20 Identities = 43/66 (65%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 I QIDVNNAFLQG EEVYM Q PGFE+ S +++C+L IYGLKQ PRA YNELK Y Sbjct: 988 IHQIDVNNAFLQGSLEEEVYMRQPPGFEDQSLSTHVCKLNKVIYGLKQAPRAWYNELKSY 1047 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1048 LLTVGF 1053 Score = 34.3 bits (77), Expect(2) = 9e-20 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = -2 Query: 102 KLEFDSSLFFMKDSVLSIYLLVYADDIIVTGS 7 K + DSSLF + + ++Y+L+Y D II+TG+ Sbjct: 1055 KSQSDSSLFILHNFGFTVYVLIYVDAIIITGN 1086 >dbj|BAM44531.1| polyprotein [Arabidopsis thaliana] Length = 1421 Score = 90.5 bits (223), Expect(2) = 9e-20 Identities = 42/66 (63%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C LK AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLKKAIYGLKQAPRAWYVELQTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 9e-20 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >dbj|BAM42646.1| polyprotein [Arabidopsis thaliana] Length = 1475 Score = 90.1 bits (222), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 52/66 (78%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKNRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >gb|AAK43485.1|AC084807_10 polyprotein, putative [Arabidopsis thaliana] gi|225898008|dbj|BAH30336.1| hypothetical protein [Arabidopsis thaliana] Length = 1459 Score = 87.0 bits (214), Expect(2) = 1e-19 Identities = 40/66 (60%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 ++Q+DVNNAFLQG EEVYM Q PGF + PS++C L+ AIYGLKQ PRA Y ELK + Sbjct: 1054 LKQLDVNNAFLQGTLTEEVYMAQPPGFVDKDRPSHVCRLRKAIYGLKQAPRAWYMELKQH 1113 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1114 LLNIGF 1119 Score = 36.6 bits (83), Expect(2) = 1e-19 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF +YLLVY DDIIVTGS Sbjct: 1125 DTSLFIYSHGTTLLYLLVYVDDIIVTGS 1152 >dbj|BAA78426.1| polyprotein [Arabidopsis thaliana] Length = 1475 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >dbj|BAM44535.1| polyprotein [Arabidopsis thaliana] Length = 1475 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKERPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >dbj|BAM44534.1| polyprotein [Arabidopsis thaliana] Length = 1475 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >dbj|BAM42650.1| Polyprotein [Arabidopsis thaliana] Length = 1475 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >dbj|BAM42649.1| Polyprotein [Arabidopsis thaliana] Length = 1475 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >dbj|BAM42647.1| polyprotein [Arabidopsis thaliana] gi|403406144|dbj|BAM42648.1| polyprotein [Arabidopsis thaliana] Length = 1475 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >gb|AAK62788.1|AC027036_9 polyprotein, putative [Arabidopsis thaliana] gi|18265373|dbj|BAB84015.1| polyprotein [Arabidopsis thaliana] Length = 1466 Score = 87.0 bits (214), Expect(2) = 1e-19 Identities = 39/66 (59%), Positives = 53/66 (80%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG ++VYM+Q PGF + P+Y+C+L+ A+YGLKQ PRA Y EL+ Y Sbjct: 1061 IRQLDVNNAFLQGTLTDDVYMSQPPGFIDKDRPNYVCKLRKALYGLKQAPRAWYVELRNY 1120 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1121 LLTIGF 1126 Score = 36.2 bits (82), Expect(2) = 1e-19 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGSSP 1 D+SLF ++ +Y+LVY DDI++TG+ P Sbjct: 1132 DTSLFVLQRGKSIVYMLVYVDDILITGNDP 1161 >dbj|BAK41511.1| polyprotein [Arabidopsis thaliana] Length = 1466 Score = 87.0 bits (214), Expect(2) = 1e-19 Identities = 39/66 (59%), Positives = 53/66 (80%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG ++VYM+Q PGF + P+Y+C+L+ A+YGLKQ PRA Y EL+ Y Sbjct: 1061 IRQLDVNNAFLQGTLTDDVYMSQPPGFIDKDRPNYVCKLRKALYGLKQAPRAWYVELRNY 1120 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1121 LLTIGF 1126 Score = 36.2 bits (82), Expect(2) = 1e-19 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGSSP 1 D+SLF ++ +Y+LVY DDI++TG+ P Sbjct: 1132 DTSLFVLQRGKSIVYMLVYVDDILITGNDP 1161 >gb|AAK62793.1|AC027036_14 polyprotein, putative [Arabidopsis thaliana] gi|338746561|dbj|BAK41510.1| polyprotein [Arabidopsis thaliana] Length = 1466 Score = 87.0 bits (214), Expect(2) = 1e-19 Identities = 39/66 (59%), Positives = 53/66 (80%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG ++VYM+Q PGF + P+Y+C+L+ A+YGLKQ PRA Y EL+ Y Sbjct: 1061 IRQLDVNNAFLQGTLTDDVYMSQPPGFIDKDRPNYVCKLRKALYGLKQAPRAWYVELRNY 1120 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1121 LLTIGF 1126 Score = 36.2 bits (82), Expect(2) = 1e-19 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGSSP 1 D+SLF ++ +Y+LVY DDI++TG+ P Sbjct: 1132 DTSLFVLQRGKSIVYMLVYVDDILITGNDP 1161 >gb|AAC79110.1| putative polyprotein of LTR transposon [Arabidopsis thaliana] gi|7269781|emb|CAB77781.1| putative polyprotein of LTR transposon [Arabidopsis thaliana] Length = 1456 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1044 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1103 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1104 LLTVGF 1109 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1115 DTSLFVLQRGRSIIYMLVYVDDILITGN 1142 >dbj|BAA78425.1| polyprotein [Arabidopsis thaliana] gi|338746551|dbj|BAK41505.1| polyprotein [Arabidopsis thaliana] gi|338746553|dbj|BAK41506.1| polyprotein [Arabidopsis thaliana] gi|338746557|dbj|BAK41508.1| polyprotein [Arabidopsis thaliana] gi|338746559|dbj|BAK41509.1| polyprotein [Arabidopsis thaliana] Length = 1447 Score = 87.0 bits (214), Expect(2) = 1e-19 Identities = 39/66 (59%), Positives = 53/66 (80%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG ++VYM+Q PGF + P+Y+C+L+ A+YGLKQ PRA Y EL+ Y Sbjct: 1042 IRQLDVNNAFLQGTLTDDVYMSQPPGFIDKDRPNYVCKLRKALYGLKQAPRAWYVELRNY 1101 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1102 LLTIGF 1107 Score = 36.2 bits (82), Expect(2) = 1e-19 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGSSP 1 D+SLF ++ +Y+LVY DDI++TG+ P Sbjct: 1113 DTSLFVLQRGKSIVYMLVYVDDILITGNDP 1142 >dbj|BAK41507.1| polyprotein [Arabidopsis thaliana] Length = 1447 Score = 87.0 bits (214), Expect(2) = 1e-19 Identities = 39/66 (59%), Positives = 53/66 (80%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG ++VYM+Q PGF + P+Y+C+L+ A+YGLKQ PRA Y EL+ Y Sbjct: 1042 IRQLDVNNAFLQGTLTDDVYMSQPPGFIDKDRPNYVCKLRKALYGLKQAPRAWYVELRNY 1101 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1102 LLTIGF 1107 Score = 36.2 bits (82), Expect(2) = 1e-19 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGSSP 1 D+SLF ++ +Y+LVY DDI++TG+ P Sbjct: 1113 DTSLFVLQRGKSIVYMLVYVDDILITGNDP 1142 >dbj|BAA78423.1| polyprotein [Arabidopsis thaliana] Length = 1431 Score = 87.0 bits (214), Expect(2) = 1e-19 Identities = 39/66 (59%), Positives = 53/66 (80%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG ++VYM+Q PGF + P+Y+C+L+ A+YGLKQ PRA Y EL+ Y Sbjct: 1026 IRQLDVNNAFLQGTLTDDVYMSQPPGFIDKDRPNYVCKLRKALYGLKQAPRAWYVELRNY 1085 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1086 LLTIGF 1091 Score = 36.2 bits (82), Expect(2) = 1e-19 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGSSP 1 D+SLF ++ +Y+LVY DDI++TG+ P Sbjct: 1097 DTSLFVLQRGKSIVYMLVYVDDILITGNDP 1126 >dbj|BAM44532.1| polyprotein [Arabidopsis thaliana] Length = 1421 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161 >dbj|BAM44530.1| polyprotein [Arabidopsis thaliana] Length = 1421 Score = 89.7 bits (221), Expect(2) = 1e-19 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 304 IRQIDVNNAFLQGLFVEEVYMTQSPGFENPSYPSYICELK*AIYGLKQGPRA*YNELKVY 125 IRQ+DVNNAFLQG +EVYM+Q PGF + P Y+C L+ AIYGLKQ PRA Y EL+ Y Sbjct: 1063 IRQLDVNNAFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRKAIYGLKQAPRAWYVELRTY 1122 Query: 124 LLSMGY 107 LL++G+ Sbjct: 1123 LLTVGF 1128 Score = 33.5 bits (75), Expect(2) = 1e-19 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -2 Query: 90 DSSLFFMKDSVLSIYLLVYADDIIVTGS 7 D+SLF ++ IY+LVY DDI++TG+ Sbjct: 1134 DTSLFVLQRGRSIIYMLVYVDDILITGN 1161