BLASTX nr result
ID: Catharanthus23_contig00017890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00017890 (237 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 70 3e-10 emb|CBI30986.3| unnamed protein product [Vitis vinifera] 58 1e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/73 (52%), Positives = 43/73 (58%) Frame = +1 Query: 7 VILPLRRAEGIRCSVKPASRIALLSKNRVAQGFRPSHTVQHPAWNGQAREMLH*DQPFGS 186 VILPL RA G RCSVKPASR AL S+N+V F H Q AWNG+AR H +P G Sbjct: 20 VILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQGRPTGP 79 Query: 187 TQCPNALFAPTRV 225 Q P L R+ Sbjct: 80 EQRPITLMPLLRL 92 >emb|CBI30986.3| unnamed protein product [Vitis vinifera] Length = 139 Score = 57.8 bits (138), Expect = 1e-06 Identities = 34/65 (52%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = -3 Query: 202 RW-DIGLTQMVGLSGAFLWPARSKRGVGPCDLGESLGPLGS*RGGQCVRLVSQSSEYLPL 26 RW D+G + VG G WPARSK G GESLG + GG V LVSQSS +LPL Sbjct: 21 RWADVGSVEQVGPDGVKCWPARSKLGDESRHPGESLGGVAPRVGGNRVSLVSQSSVHLPL 80 Query: 25 SAVEG 11 +VEG Sbjct: 81 PSVEG 85