BLASTX nr result
ID: Catharanthus23_contig00017462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00017462 (343 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase ... 98 1e-18 ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase ... 97 3e-18 gb|AAX07129.1| calcium-dependent protein kinase 4 [Capsicum annuum] 96 5e-18 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 96 6e-18 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 96 6e-18 gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 96 6e-18 ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 95 8e-18 ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase ... 95 8e-18 ref|XP_006351224.1| PREDICTED: calcium-dependent protein kinase ... 94 1e-17 ref|XP_004249195.1| PREDICTED: calcium-dependent protein kinase ... 94 1e-17 gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 94 1e-17 ref|XP_006399766.1| hypothetical protein EUTSA_v10013170mg [Eutr... 94 2e-17 gb|EOY09297.1| Calcium-dependent protein kinase 19 [Theobroma ca... 94 2e-17 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 94 2e-17 gb|EMJ12932.1| hypothetical protein PRUPE_ppa006164mg [Prunus pe... 93 3e-17 ref|XP_002322709.1| calcium-dependent protein kinase [Populus tr... 93 3e-17 emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana pl... 93 3e-17 ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase ... 93 4e-17 gb|EPS73534.1| calcium-dependent protein kinase 8, partial [Genl... 93 4e-17 ref|NP_001060031.1| Os07g0568600 [Oryza sativa Japonica Group] g... 93 4e-17 >ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum lycopersicum] Length = 533 Score = 98.2 bits (243), Expect = 1e-18 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTEAGR 163 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGSIQV E GR Sbjct: 480 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSIQVGKEEGR 533 >ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum tuberosum] Length = 532 Score = 96.7 bits (239), Expect = 3e-18 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTEAGR 163 DKDGRISY+EF MMKAGTDWRKASRQYSRER+NSLSLKLM+DGSIQV E GR Sbjct: 479 DKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSIQVGKEEGR 532 >gb|AAX07129.1| calcium-dependent protein kinase 4 [Capsicum annuum] Length = 524 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQ 142 DKDGRISYDEF+AMMKAGTDWRKASRQYSRERYNSLSLKLMKDGS+Q Sbjct: 477 DKDGRISYDEFSAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSLQ 523 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTE 154 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGS+Q+T E Sbjct: 480 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLTNE 530 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTE 154 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGS+Q+T E Sbjct: 480 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLTNE 530 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 95.5 bits (236), Expect = 6e-18 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTE 154 DKDGRISYDEF+ MMK GTDWRKASRQYSRERYNSLSLKLMKDGS+Q++ E Sbjct: 478 DKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGSLQMSNE 528 >ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 530 Score = 95.1 bits (235), Expect = 8e-18 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTEA 157 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGS+ +T EA Sbjct: 478 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHLTNEA 529 >ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 531 Score = 95.1 bits (235), Expect = 8e-18 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTEA 157 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGS+ +T EA Sbjct: 479 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHLTNEA 530 >ref|XP_006351224.1| PREDICTED: calcium-dependent protein kinase 32-like [Solanum tuberosum] Length = 524 Score = 94.4 bits (233), Expect = 1e-17 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQ 142 DKDGRISYDEF+ MMKAGTDWRKASRQYSRERYNSLSLKLMKDGS+Q Sbjct: 477 DKDGRISYDEFSTMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSLQ 523 >ref|XP_004249195.1| PREDICTED: calcium-dependent protein kinase 32-like [Solanum lycopersicum] Length = 525 Score = 94.4 bits (233), Expect = 1e-17 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQ 142 DKDGRISYDEF+ MMKAGTDWRKASRQYSRERYNSLSLKLMKDGS+Q Sbjct: 478 DKDGRISYDEFSTMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSLQ 524 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 94.4 bits (233), Expect = 1e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTEAGR 163 DKDGRISYDEF MMKAGTDWRKASRQYSRER+N+LSLKLMKDGS+Q+ E R Sbjct: 483 DKDGRISYDEFAVMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMNNEPRR 536 >ref|XP_006399766.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|567173219|ref|XP_006399767.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|557100856|gb|ESQ41219.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|557100857|gb|ESQ41220.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] Length = 548 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTEA 157 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGS+Q+ EA Sbjct: 497 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLEGEA 548 >gb|EOY09297.1| Calcium-dependent protein kinase 19 [Theobroma cacao] Length = 533 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTE 154 DKDGRISYDEF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGS+Q E Sbjct: 481 DKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQSNNE 531 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTE 154 DKDGRISYDEF AMMKAGTDWRKASRQYSRER+N+LSLKLM+DGS+Q+ E Sbjct: 482 DKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMRDGSLQMNNE 532 >gb|EMJ12932.1| hypothetical protein PRUPE_ppa006164mg [Prunus persica] Length = 425 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/51 (82%), Positives = 49/51 (96%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTE 154 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NS+SLKLM++GS+Q+ TE Sbjct: 373 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGSLQLATE 423 >ref|XP_002322709.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222867339|gb|EEF04470.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 532 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/51 (82%), Positives = 50/51 (98%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTE 154 DKDG+ISY+EF AMMKAGTDWRKASRQYSRER+N+LSLKLMKDGS+++T+E Sbjct: 480 DKDGKISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLKLTSE 530 >emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana plumbaginifolia] Length = 528 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTEA 157 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGS+Q+ +A Sbjct: 477 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLENKA 528 >ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase 8-like [Solanum tuberosum] Length = 533 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQV 145 DKDGRISY+EF AMMKAGTDWRKASRQYSRER+NSLSLKLM+DGS+QV Sbjct: 482 DKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQV 529 >gb|EPS73534.1| calcium-dependent protein kinase 8, partial [Genlisea aurea] Length = 533 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTTE 154 DKDG+ISYDEF MMKAGTDWRKASRQYSRER+NSLSLKLM++GS+Q+T E Sbjct: 483 DKDGKISYDEFAGMMKAGTDWRKASRQYSRERFNSLSLKLMREGSLQLTNE 533 >ref|NP_001060031.1| Os07g0568600 [Oryza sativa Japonica Group] gi|34393291|dbj|BAC83205.1| putative calcium-dependent protein kinase [Oryza sativa Japonica Group] gi|113611567|dbj|BAF21945.1| Os07g0568600 [Oryza sativa Japonica Group] gi|125600773|gb|EAZ40349.1| hypothetical protein OsJ_24795 [Oryza sativa Japonica Group] Length = 550 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 2 DKDGRISYDEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSIQVTT 151 DKDG+ISYDEF AMMKAGTDWRKASRQYSRER+ SLSLKL KDGS+Q+TT Sbjct: 499 DKDGKISYDEFAAMMKAGTDWRKASRQYSRERFTSLSLKLQKDGSLQLTT 548