BLASTX nr result
ID: Catharanthus23_contig00017243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00017243 (743 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526240.1| conserved hypothetical protein [Ricinus comm... 68 3e-09 >ref|XP_002526240.1| conserved hypothetical protein [Ricinus communis] gi|223534434|gb|EEF36137.1| conserved hypothetical protein [Ricinus communis] Length = 393 Score = 68.2 bits (165), Expect = 3e-09 Identities = 48/133 (36%), Positives = 68/133 (51%), Gaps = 9/133 (6%) Frame = +3 Query: 3 LDNETLLPIASPPIRYPYKKETISC-KESQGRLYFIEFDCYYTLSKFHVYELEKDEMKWL 179 +D E + + P Y + K ES G L+ IE T ++F+VYE+EKD W Sbjct: 233 MDRECISSMPKLPFSYEWGKRRFRYFGESDGHLHLIEIYGLRT-TQFNVYEMEKDYSFWR 291 Query: 180 LRYNVDLGDYIK------ESKLDWSRQNLP--ILLSLIHGDNKEETGLLLYTNCQVLSYK 335 +RY V L + S LD N ++LSL+ D EE+ LLL+ +V+SY Sbjct: 292 IRYRVQLDHVVAAFPEMVRSYLDAGDSNYYAFVVLSLVEEDATEESSLLLHIPGKVISYN 351 Query: 336 LKNKACVKVCDLN 374 LKNK KVC+L+ Sbjct: 352 LKNKTFKKVCELS 364