BLASTX nr result
ID: Catharanthus23_contig00015233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00015233 (533 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16334.3| unnamed protein product [Vitis vinifera] 58 1e-06 >emb|CBI16334.3| unnamed protein product [Vitis vinifera] Length = 635 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = -2 Query: 133 SGTSETSKWTCTCSTADQGNLSYVVPVRCYSSCDCSP--GGSSENR 2 S TS +KWTCTCS+A+QG+ +Y++ C +SCDCSP GGS+ +R Sbjct: 27 SDTSNINKWTCTCSSANQGSQNYILAGNCSTSCDCSPAGGGSTGDR 72