BLASTX nr result
ID: Catharanthus23_contig00015070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00015070 (538 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform... 55 8e-06 >gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 498 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +1 Query: 1 KHDPDWLIKQRTQEVEIIQKWLHEYYIDIK 90 K DPDWL++QR QEVEIIQKWL+EYY D++ Sbjct: 467 KDDPDWLVEQRRQEVEIIQKWLNEYYADLR 496