BLASTX nr result
ID: Catharanthus23_contig00013810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00013810 (600 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65256.1| hypothetical protein L484_025334 [Morus notabilis] 64 4e-08 >gb|EXB65256.1| hypothetical protein L484_025334 [Morus notabilis] Length = 987 Score = 63.5 bits (153), Expect = 4e-08 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 112 TGDKDGRKSTSSSFFTLAGNCIL*KSQLQLIVALSTIEAEYIAG 243 TGD+D R+STS+ TL GNCI KSQLQL+VALS+IEAEYIAG Sbjct: 100 TGDRDRRQSTSAYMMTLDGNCISWKSQLQLVVALSSIEAEYIAG 143