BLASTX nr result
ID: Catharanthus23_contig00013182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00013182 (624 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006440836.1| hypothetical protein CICLE_v10018700mg [Citr... 107 3e-21 ref|XP_006485726.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_004516865.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 gb|AAW81739.1| Putative Putative Pentatricopeptide (PPR) repeat-... 104 2e-20 ref|XP_003595674.1| Pentatricopeptide repeat protein [Medicago t... 104 2e-20 ref|XP_002322051.2| pentatricopeptide repeat-containing family p... 103 5e-20 ref|XP_002512026.1| pentatricopeptide repeat-containing protein,... 103 5e-20 ref|XP_002890279.1| pentatricopeptide repeat-containing protein ... 102 7e-20 emb|CAA06830.1| DYW8 protein [Arabidopsis thaliana] 102 1e-19 gb|ESW10380.1| hypothetical protein PHAVU_009G204200g [Phaseolus... 102 1e-19 ref|NP_564054.1| pentatricopeptide repeat-containing protein [Ar... 102 1e-19 dbj|BAF01440.1| hypothetical protein [Arabidopsis thaliana] 102 1e-19 ref|XP_004301089.1| PREDICTED: pentatricopeptide repeat-containi... 99 7e-19 gb|EMJ12183.1| hypothetical protein PRUPE_ppa021532mg [Prunus pe... 99 1e-18 ref|XP_003528249.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 emb|CBI15366.3| unnamed protein product [Vitis vinifera] 99 1e-18 ref|XP_002463828.1| hypothetical protein SORBIDRAFT_01g006970 [S... 99 1e-18 ref|XP_002268440.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 gb|EXB38821.1| Serine acetyltransferase 5 [Morus notabilis] 98 2e-18 ref|XP_006650653.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 >ref|XP_006440836.1| hypothetical protein CICLE_v10018700mg [Citrus clementina] gi|557543098|gb|ESR54076.1| hypothetical protein CICLE_v10018700mg [Citrus clementina] Length = 980 Score = 107 bits (267), Expect = 3e-21 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 LKTTKD+TL+V KNLRIC DCHNA KL+SKV RE++VRDNKRFHHF+DG CSCGDYW Sbjct: 923 LKTTKDLTLRVCKNLRICVDCHNAAKLISKVAEREIVVRDNKRFHHFRDGVCSCGDYW 980 >ref|XP_006485726.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Citrus sinensis] Length = 980 Score = 107 bits (266), Expect = 4e-21 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 LKTTKD+TL+V KNLRIC DCHNA KL+SKV RE+++RDNKRFHHF+DG CSCGDYW Sbjct: 923 LKTTKDLTLRVCKNLRICVDCHNAAKLISKVAEREIVIRDNKRFHHFRDGVCSCGDYW 980 >ref|XP_004516865.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Cicer arietinum] Length = 988 Score = 104 bits (259), Expect = 2e-20 Identities = 47/58 (81%), Positives = 49/58 (84%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 L T K TL+V KNLRIC DCHNAIKLVSKV RE+IVRDNKRFHHFK GFCSCGDYW Sbjct: 931 LNTAKGTTLRVCKNLRICVDCHNAIKLVSKVAKREIIVRDNKRFHHFKKGFCSCGDYW 988 >gb|AAW81739.1| Putative Putative Pentatricopeptide (PPR) repeat-containing protein [Brassica oleracea] Length = 968 Score = 104 bits (259), Expect = 2e-20 Identities = 43/58 (74%), Positives = 52/58 (89%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 ++T++ TL+VYKNLRIC DCHNA KL+SKV RE++VRDNKRFHHFK+GFCSCGDYW Sbjct: 911 IRTSEGTTLRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFKNGFCSCGDYW 968 >ref|XP_003595674.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355484722|gb|AES65925.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 975 Score = 104 bits (259), Expect = 2e-20 Identities = 46/58 (79%), Positives = 50/58 (86%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 L T K TL+V KNLRIC DCHNAIKLVSK+ RE+IVRDNKRFHHFK+GFCSCGDYW Sbjct: 918 LNTAKGTTLRVCKNLRICVDCHNAIKLVSKIDKREIIVRDNKRFHHFKNGFCSCGDYW 975 >ref|XP_002322051.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550321866|gb|EEF06178.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 837 Score = 103 bits (256), Expect = 5e-20 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 LKTTK TL++YKNLRIC DCHNA KL+SK RE++VRDNKRFHHF+DG CSC DYW Sbjct: 780 LKTTKGTTLRIYKNLRICADCHNAAKLISKAVEREIVVRDNKRFHHFRDGLCSCCDYW 837 >ref|XP_002512026.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549206|gb|EEF50695.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 810 Score = 103 bits (256), Expect = 5e-20 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 L TTK TL+++KNLRIC DCHNA K +S+VT RE+I+RDNKRFHHFKDG CSCGDYW Sbjct: 753 LNTTKGTTLRIFKNLRICVDCHNASKFMSEVTGREIIIRDNKRFHHFKDGLCSCGDYW 810 >ref|XP_002890279.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336121|gb|EFH66538.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 953 Score = 102 bits (255), Expect = 7e-20 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 +KT++ TL+VYKNLRIC DCHNA KL+SKV RE++VRDNKRFHHF GFCSCGDYW Sbjct: 896 IKTSEGTTLRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFNKGFCSCGDYW 953 >emb|CAA06830.1| DYW8 protein [Arabidopsis thaliana] Length = 146 Score = 102 bits (253), Expect = 1e-19 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 +KT++ T++VYKNLRIC DCHNA KL+SKV RE++VRDNKRFHHFK+G CSCGDYW Sbjct: 89 IKTSEGTTIRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFKNGVCSCGDYW 146 >gb|ESW10380.1| hypothetical protein PHAVU_009G204200g [Phaseolus vulgaris] Length = 982 Score = 102 bits (253), Expect = 1e-19 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 L T K TL++ KNLRIC DCHNAIKLVSKV R+++VRDNKRFHHFK+GFC+CGDYW Sbjct: 925 LNTAKGTTLRICKNLRICVDCHNAIKLVSKVVERDIVVRDNKRFHHFKNGFCTCGDYW 982 >ref|NP_564054.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806507|sp|Q0WN60.2|PPR48_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g18485 gi|332191599|gb|AEE29720.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 970 Score = 102 bits (253), Expect = 1e-19 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 +KT++ T++VYKNLRIC DCHNA KL+SKV RE++VRDNKRFHHFK+G CSCGDYW Sbjct: 913 IKTSEGTTIRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFKNGVCSCGDYW 970 >dbj|BAF01440.1| hypothetical protein [Arabidopsis thaliana] Length = 720 Score = 102 bits (253), Expect = 1e-19 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 +KT++ T++VYKNLRIC DCHNA KL+SKV RE++VRDNKRFHHFK+G CSCGDYW Sbjct: 663 IKTSEGTTIRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFKNGVCSCGDYW 720 >ref|XP_004301089.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Fragaria vesca subsp. vesca] Length = 957 Score = 99.4 bits (246), Expect = 7e-19 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 LK K T++V KNLRIC DCHNA KL+SK RE+IVRDNKRFHHFKDG CSCGDYW Sbjct: 900 LKMNKGATVRVCKNLRICLDCHNAAKLISKAVEREIIVRDNKRFHHFKDGLCSCGDYW 957 >gb|EMJ12183.1| hypothetical protein PRUPE_ppa021532mg [Prunus persica] Length = 840 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/58 (72%), Positives = 48/58 (82%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 LK +K TL++ KNLRIC DCHNA KL+SKV RE++VRDNKRFHHFK G CSCGDYW Sbjct: 783 LKMSKGATLRICKNLRICVDCHNAAKLISKVVEREIVVRDNKRFHHFKHGLCSCGDYW 840 >ref|XP_003528249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Glycine max] Length = 975 Score = 99.0 bits (245), Expect = 1e-18 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 L T K TL+V KNLRIC DCHNAIKLVSKV R++IVRDNKRFHHFK+G C+CGD+W Sbjct: 918 LNTAKGTTLRVCKNLRICVDCHNAIKLVSKVVKRDIIVRDNKRFHHFKNGLCTCGDFW 975 >emb|CBI15366.3| unnamed protein product [Vitis vinifera] Length = 783 Score = 98.6 bits (244), Expect = 1e-18 Identities = 40/58 (68%), Positives = 48/58 (82%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 L T K + ++VYKNLRIC DCHNA K +SKV R+++VRDNKRFHHF+DG CSCGDYW Sbjct: 726 LNTAKGLPVRVYKNLRICGDCHNAAKFISKVVNRDIVVRDNKRFHHFRDGICSCGDYW 783 >ref|XP_002463828.1| hypothetical protein SORBIDRAFT_01g006970 [Sorghum bicolor] gi|241917682|gb|EER90826.1| hypothetical protein SORBIDRAFT_01g006970 [Sorghum bicolor] Length = 304 Score = 98.6 bits (244), Expect = 1e-18 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 + T+ L+V KNLRIC DCHNA+KL++KVT RE++VRDNKRFHHFKDG CSCGDYW Sbjct: 247 VSTSPGTPLRVMKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 304 >ref|XP_002268440.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Vitis vinifera] Length = 881 Score = 98.6 bits (244), Expect = 1e-18 Identities = 40/58 (68%), Positives = 48/58 (82%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 L T K + ++VYKNLRIC DCHNA K +SKV R+++VRDNKRFHHF+DG CSCGDYW Sbjct: 824 LNTAKGLPVRVYKNLRICGDCHNAAKFISKVVNRDIVVRDNKRFHHFRDGICSCGDYW 881 >gb|EXB38821.1| Serine acetyltransferase 5 [Morus notabilis] Length = 819 Score = 97.8 bits (242), Expect = 2e-18 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 + T TL++ KNLRIC DCHNAIK++SK+ RE+IVRDNKRFHHFKDG CSCGDYW Sbjct: 762 ISTPPRTTLRIMKNLRICGDCHNAIKIMSKIVGRELIVRDNKRFHHFKDGKCSCGDYW 819 >ref|XP_006650653.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Oryza brachyantha] Length = 297 Score = 97.8 bits (242), Expect = 2e-18 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +2 Query: 5 LKTTKDVTLKVYKNLRICQDCHNAIKLVSKVTFREMIVRDNKRFHHFKDGFCSCGDYW 178 + T L+V KNLRIC DCHNA+KL++KVT RE++VRDNKRFHHFKDG CSCGDYW Sbjct: 240 VSTPPGTPLRVIKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 297