BLASTX nr result
ID: Catharanthus23_contig00012787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00012787 (338 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344313.1| PREDICTED: uncharacterized protein LOC102581... 57 3e-06 ref|XP_004239410.1| PREDICTED: probable serine/threonine-protein... 56 6e-06 ref|XP_006344304.1| PREDICTED: probable receptor-like protein ki... 55 1e-05 >ref|XP_006344313.1| PREDICTED: uncharacterized protein LOC102581608 [Solanum tuberosum] Length = 262 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -1 Query: 137 SCPKEFQCPNLGNLSFPFTNISKPDCGLCLVDCNNKSQ 24 SCPKEF C LG++S+PF+ +KP CGL +DCNN Q Sbjct: 28 SCPKEFNCGRLGSMSYPFSEFNKPYCGLSKIDCNNTFQ 65 >ref|XP_004239410.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like [Solanum lycopersicum] Length = 662 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/42 (52%), Positives = 29/42 (69%) Frame = -1 Query: 149 QEPNSCPKEFQCPNLGNLSFPFTNISKPDCGLCLVDCNNKSQ 24 + +SCPKEF C LG +S+PF+ +KP CGL +DCNN Q Sbjct: 21 ESKSSCPKEFNCGRLGIMSYPFSEFNKPYCGLSKIDCNNTFQ 62 >ref|XP_006344304.1| PREDICTED: probable receptor-like protein kinase At1g67000-like [Solanum tuberosum] Length = 422 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = -1 Query: 140 NSCPKEFQCPNLGNLSFPFTNISKPDCGLCLVDCNNK 30 ++C EF+C LG + FPFTN S P+CGLC DCN K Sbjct: 25 SNCTDEFECGGLGAMKFPFTNSSNPECGLCRFDCNTK 61