BLASTX nr result
ID: Catharanthus23_contig00009654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00009654 (1536 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299164.1| predicted protein [Populus trichocarpa] 107 1e-20 gb|ABK96444.1| unknown [Populus trichocarpa x Populus deltoides] 107 2e-20 ref|XP_002303969.1| predicted protein [Populus trichocarpa] 104 1e-19 gb|ESW22823.1| hypothetical protein PHAVU_005G184200g [Phaseolus... 102 4e-19 ref|XP_006385951.1| hypothetical protein POPTR_0003s18640g [Popu... 101 1e-18 ref|XP_002512777.1| conserved hypothetical protein [Ricinus comm... 99 4e-18 ref|XP_006493446.1| PREDICTED: uncharacterized protein LOC102619... 95 7e-17 gb|EXC14087.1| hypothetical protein L484_004412 [Morus notabilis] 94 1e-16 ref|XP_006427699.1| hypothetical protein CICLE_v10026849mg [Citr... 94 1e-16 ref|XP_003637290.1| hypothetical protein MTR_080s0045 [Medicago ... 92 5e-16 gb|AFK46042.1| unknown [Lotus japonicus] 92 6e-16 ref|XP_004137647.1| PREDICTED: uncharacterized protein LOC101215... 91 1e-15 ref|XP_002269716.1| PREDICTED: uncharacterized protein LOC100255... 89 5e-15 gb|EMJ19069.1| hypothetical protein PRUPE_ppa021322mg, partial [... 82 6e-13 ref|XP_004487210.1| PREDICTED: uncharacterized protein LOC101489... 77 2e-11 emb|CBW30212.1| Conserved hypothetical protein [Musa balbisiana] 72 6e-10 emb|CBW30174.1| Conserved hypothetical protein [Musa balbisiana] 72 6e-10 ref|XP_006366270.1| PREDICTED: uncharacterized protein LOC102582... 71 1e-09 ref|XP_004241669.1| PREDICTED: uncharacterized protein LOC101254... 70 3e-09 ref|XP_002510114.1| conserved hypothetical protein [Ricinus comm... 67 2e-08 >ref|XP_002299164.1| predicted protein [Populus trichocarpa] Length = 92 Score = 107 bits (268), Expect = 1e-20 Identities = 50/67 (74%), Positives = 58/67 (86%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSP 329 RK GA LLKL +D+QTCGYEDVQVMWE+LRR+ESEL++SH KR K RPFWRVFVWSN S Sbjct: 25 RKNGANLLKLHNDVQTCGYEDVQVMWEILRRSESELMASHPKR-KQRPFWRVFVWSNHSA 83 Query: 328 ATSFDSN 308 A+SF +N Sbjct: 84 ASSFSAN 90 >gb|ABK96444.1| unknown [Populus trichocarpa x Populus deltoides] Length = 92 Score = 107 bits (266), Expect = 2e-20 Identities = 50/67 (74%), Positives = 57/67 (85%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSP 329 RK GA LLKL +D+QTCGYEDVQVMWE+LRR+ESEL++SH KR K RPFWRVFVWSN S Sbjct: 25 RKNGANLLKLHNDVQTCGYEDVQVMWEILRRSESELMASHPKR-KQRPFWRVFVWSNHSA 83 Query: 328 ATSFDSN 308 A+SF N Sbjct: 84 ASSFSPN 90 >ref|XP_002303969.1| predicted protein [Populus trichocarpa] Length = 90 Score = 104 bits (259), Expect = 1e-19 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSP 329 RK GAGLL+L +D+QTCGYEDVQVMWE+LRR+ESEL++S KR K RPFWRVFVWSN S Sbjct: 23 RKNGAGLLELHNDVQTCGYEDVQVMWEILRRSESELMASLPKR-KQRPFWRVFVWSNHSA 81 Query: 328 ATSFDSN 308 A+SF +N Sbjct: 82 ASSFSAN 88 >gb|ESW22823.1| hypothetical protein PHAVU_005G184200g [Phaseolus vulgaris] Length = 132 Score = 102 bits (254), Expect = 4e-19 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSP 329 RK GAGLLKL+DD+QTCGYEDVQVMWEML+RTES+++ +H KR K PFWR+FVWSN S Sbjct: 65 RKNGAGLLKLQDDVQTCGYEDVQVMWEMLQRTESDVVENHHKR-KQLPFWRIFVWSNHSE 123 Query: 328 ATSFDSN 308 +S +N Sbjct: 124 VSSESAN 130 >ref|XP_006385951.1| hypothetical protein POPTR_0003s18640g [Populus trichocarpa] gi|550343476|gb|ERP63748.1| hypothetical protein POPTR_0003s18640g [Populus trichocarpa] Length = 144 Score = 101 bits (251), Expect = 1e-18 Identities = 51/77 (66%), Positives = 60/77 (77%) Frame = -3 Query: 538 FSSFFLHDHQRKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFW 359 FSS F GAGLL+L +D+QTCGYEDVQVMWE+LRR+ESEL++S KR K RPFW Sbjct: 73 FSSMFC------AGAGLLELHNDVQTCGYEDVQVMWEILRRSESELMASLPKR-KQRPFW 125 Query: 358 RVFVWSNQSPATSFDSN 308 RVFVWSN S A+SF +N Sbjct: 126 RVFVWSNHSAASSFSAN 142 >ref|XP_002512777.1| conserved hypothetical protein [Ricinus communis] gi|223547788|gb|EEF49280.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 99.4 bits (246), Expect = 4e-18 Identities = 47/69 (68%), Positives = 57/69 (82%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSP 329 R GAGLLKLR+D+QTCGYEDVQVMWEMLRR+ESE I++++KR K R FWR VWSNQ+ Sbjct: 25 RNHGAGLLKLRNDVQTCGYEDVQVMWEMLRRSESEQIANYSKR-KQRSFWRALVWSNQNA 83 Query: 328 ATSFDSNPA 302 A+S +N A Sbjct: 84 ASSLSANHA 92 >ref|XP_006493446.1| PREDICTED: uncharacterized protein LOC102619868 [Citrus sinensis] Length = 92 Score = 95.1 bits (235), Expect = 7e-17 Identities = 43/66 (65%), Positives = 53/66 (80%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSP 329 RK GAG+LKLRDD+QTC Y+DVQVMWEML R+ESE+I+ + KR + RPFWRV VWSN Sbjct: 25 RKNGAGILKLRDDVQTCEYQDVQVMWEMLSRSESEMINHNPKR-RQRPFWRVLVWSNHGS 83 Query: 328 ATSFDS 311 + SF + Sbjct: 84 SASFSA 89 >gb|EXC14087.1| hypothetical protein L484_004412 [Morus notabilis] Length = 95 Score = 94.4 bits (233), Expect = 1e-16 Identities = 47/71 (66%), Positives = 53/71 (74%), Gaps = 5/71 (7%) Frame = -3 Query: 499 GAGLLKLRDDIQTCGYEDVQVMWEMLRRTESEL----ISSHAKRNKHRPFWRVFVWSNQS 332 GAGLLKL DD+Q CGY+DVQVMWEML+R+ESEL +H KRNK RPFW VFVWSN S Sbjct: 25 GAGLLKLHDDVQMCGYQDVQVMWEMLQRSESELNGHNHENHPKRNKQRPFWSVFVWSNNS 84 Query: 331 PA-TSFDSNPA 302 SF +N A Sbjct: 85 TTDPSFSANHA 95 >ref|XP_006427699.1| hypothetical protein CICLE_v10026849mg [Citrus clementina] gi|557529689|gb|ESR40939.1| hypothetical protein CICLE_v10026849mg [Citrus clementina] Length = 92 Score = 94.4 bits (233), Expect = 1e-16 Identities = 43/66 (65%), Positives = 53/66 (80%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSP 329 RK GAG+LKLRDD+QTC Y+DVQVMWEML R+ESE+I+ + KR + RPFWRV VWSN Sbjct: 25 RKNGAGILKLRDDVQTCEYQDVQVMWEMLSRSESEMINHNPKR-RQRPFWRVSVWSNHGS 83 Query: 328 ATSFDS 311 + SF + Sbjct: 84 SASFSA 89 >ref|XP_003637290.1| hypothetical protein MTR_080s0045 [Medicago truncatula] gi|355503225|gb|AES84428.1| hypothetical protein MTR_080s0045 [Medicago truncatula] Length = 161 Score = 92.4 bits (228), Expect = 5e-16 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 2/71 (2%) Frame = -3 Query: 514 HQRKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVW--S 341 + RK GAGL+KL+DD+QTCGYEDVQVMWEML++TE+EL+ +H KR K PFWR+FV S Sbjct: 90 NHRKNGAGLVKLQDDVQTCGYEDVQVMWEMLQKTETELVDNHHKR-KQLPFWRLFVCSNS 148 Query: 340 NQSPATSFDSN 308 N + A+S SN Sbjct: 149 NHTKASSQSSN 159 >gb|AFK46042.1| unknown [Lotus japonicus] Length = 157 Score = 92.0 bits (227), Expect = 6e-16 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = -3 Query: 505 KTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSPA 326 K GAGLLKL+DD+QTCGY DVQVMWE+L+RTESE+I KR K PFWR+FVWSN A Sbjct: 90 KNGAGLLKLQDDVQTCGYSDVQVMWEILQRTESEVIDKCHKR-KQLPFWRIFVWSNHHEA 148 Query: 325 TS 320 +S Sbjct: 149 SS 150 >ref|XP_004137647.1| PREDICTED: uncharacterized protein LOC101215661 [Cucumis sativus] Length = 103 Score = 91.3 bits (225), Expect = 1e-15 Identities = 37/63 (58%), Positives = 50/63 (79%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSP 329 R+ GLLKL DD++TCGY+DV+VMWE+LRR+E+ELI+ H R KH+PFW+ VWSN + Sbjct: 25 RRNDEGLLKLHDDVETCGYQDVKVMWEILRRSEAELINHHQMRRKHKPFWKALVWSNHNS 84 Query: 328 ATS 320 +S Sbjct: 85 NSS 87 >ref|XP_002269716.1| PREDICTED: uncharacterized protein LOC100255236 [Vitis vinifera] gi|298204741|emb|CBI25239.3| unnamed protein product [Vitis vinifera] Length = 93 Score = 89.0 bits (219), Expect = 5e-15 Identities = 44/70 (62%), Positives = 51/70 (72%), Gaps = 1/70 (1%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEM-LRRTESELISSHAKRNKHRPFWRVFVWSNQS 332 RK G GLLKL DD+QTC Y+DV MW M L R+ESE S H KR KHRPFWRVFVWSN + Sbjct: 25 RKNGGGLLKLHDDVQTCEYDDVHRMWNMMLSRSESEHGSQHTKR-KHRPFWRVFVWSNHN 83 Query: 331 PATSFDSNPA 302 ++SF + A Sbjct: 84 SSSSFSAKHA 93 >gb|EMJ19069.1| hypothetical protein PRUPE_ppa021322mg, partial [Prunus persica] Length = 78 Score = 82.0 bits (201), Expect = 6e-13 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%) Frame = -3 Query: 499 GAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVW-SNQSPAT 323 GAGLLKL DD+QTCGY+DVQVMW+ML R ++EL S H+KR K RPFWRVF + SN S + Sbjct: 14 GAGLLKLHDDVQTCGYQDVQVMWQMLSR-DTELTSHHSKR-KQRPFWRVFEFSSNNSKPS 71 Query: 322 SFDSNPA 302 SN A Sbjct: 72 PLSSNHA 78 >ref|XP_004487210.1| PREDICTED: uncharacterized protein LOC101489986 [Cicer arietinum] Length = 179 Score = 77.4 bits (189), Expect = 2e-11 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -3 Query: 514 HQRKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVF 350 + RK GAGLLKL+DD+QTC YEDVQVMWEML + E+++ + + K PFWRVF Sbjct: 113 NHRKNGAGLLKLQDDVQTCEYEDVQVMWEMLHKNETQVTEHNHHKRKQLPFWRVF 167 >emb|CBW30212.1| Conserved hypothetical protein [Musa balbisiana] Length = 107 Score = 72.0 bits (175), Expect = 6e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -3 Query: 499 GAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSPAT 323 G G+ KL DD+Q CGY+DVQVMWEM+RR+E EL S+ ++ + R WR+ WSN++ +T Sbjct: 45 GGGIQKLHDDVQMCGYQDVQVMWEMVRRSEMEL--SNERKRRKRLLWRIPTWSNRTSST 101 >emb|CBW30174.1| Conserved hypothetical protein [Musa balbisiana] Length = 108 Score = 72.0 bits (175), Expect = 6e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -3 Query: 499 GAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKRNKHRPFWRVFVWSNQSPAT 323 G G+ KL DD+Q CGY+DVQVMWEM+RR+E EL S+ ++ + R WR+ WSN++ +T Sbjct: 46 GGGIQKLHDDVQMCGYQDVQVMWEMVRRSEMEL--SNERKRRKRLLWRIPTWSNRTSST 102 >ref|XP_006366270.1| PREDICTED: uncharacterized protein LOC102582729 [Solanum tuberosum] Length = 74 Score = 70.9 bits (172), Expect = 1e-09 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKR 380 RK GAGLLKL+ DIQ+CGYEDVQVMWEML TESEL S H KR Sbjct: 26 RKDGAGLLKLQGDIQSCGYEDVQVMWEMLGGTESELTSRHIKR 68 >ref|XP_004241669.1| PREDICTED: uncharacterized protein LOC101254501 [Solanum lycopersicum] Length = 120 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 508 RKTGAGLLKLRDDIQTCGYEDVQVMWEMLRRTESELISSHAKR 380 RK GAGLLKL+ DIQ+CGYEDVQVMWEML T+SEL S H KR Sbjct: 72 RKDGAGLLKLQGDIQSCGYEDVQVMWEMLGGTDSELTSRHIKR 114 >ref|XP_002510114.1| conserved hypothetical protein [Ricinus communis] gi|223550815|gb|EEF52301.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 67.4 bits (163), Expect = 2e-08 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = -3 Query: 493 GLLKLRDDIQTCGYEDVQVMWEMLRRTESELI-SSHAKRNKHRPFWRVFVWSNQSP 329 GLLKLR D++ C YEDV++MWEMLRRTE+E S ++K R FW+ F W+ SP Sbjct: 28 GLLKLRHDVRACEYEDVRIMWEMLRRTETESARQSQPVKSKKRCFWKCFSWARCSP 83