BLASTX nr result
ID: Catharanthus23_contig00009608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00009608 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307035.1| PREDICTED: 54S ribosomal protein L51, mitoch... 100 3e-19 ref|XP_004307034.1| PREDICTED: 54S ribosomal protein L51, mitoch... 100 3e-19 gb|EMJ27055.1| hypothetical protein PRUPE_ppa013515mg [Prunus pe... 96 5e-18 ref|XP_004985267.1| PREDICTED: 54S ribosomal protein L51, mitoch... 93 3e-17 gb|EOY04682.1| Mitochondrial ribosomal protein L51/S25/CI-B8 fam... 93 4e-17 ref|NP_191524.1| mitochondrial ribosomal protein L51/S25/CI-B8 f... 93 4e-17 ref|NP_001190137.1| mitochondrial ribosomal protein L51/S25/CI-B... 93 4e-17 ref|XP_002876517.1| mitochondrial ribosomal protein L51/S25/CI-B... 93 4e-17 ref|XP_002465669.1| hypothetical protein SORBIDRAFT_01g043440 [S... 93 4e-17 ref|XP_002438166.1| hypothetical protein SORBIDRAFT_10g009060 [S... 93 4e-17 tpg|DAA43879.1| TPA: hypothetical protein ZEAMMB73_621483 [Zea m... 93 4e-17 ref|NP_001130710.1| hypothetical protein [Zea mays] gi|194689906... 93 4e-17 ref|XP_006856003.1| hypothetical protein AMTR_s00059p00033240 [A... 92 5e-17 ref|NP_001173310.1| Os03g0207250 [Oryza sativa Japonica Group] g... 92 5e-17 ref|XP_006649598.1| PREDICTED: 54S ribosomal protein L51, mitoch... 92 9e-17 gb|AFK38190.1| unknown [Medicago truncatula] 92 9e-17 ref|NP_001148774.1| LOC100282391 [Zea mays] gi|195622062|gb|ACG3... 92 9e-17 ref|XP_003627415.1| Mitochondrial ribosomal protein L43 [Medicag... 92 9e-17 ref|XP_006402670.1| hypothetical protein EUTSA_v10006316mg [Eutr... 91 2e-16 ref|XP_002530576.1| 60S ribosomal protein L51, putative [Ricinus... 91 2e-16 >ref|XP_004307035.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 2 [Fragaria vesca subsp. vesca] gi|470142691|ref|XP_004307036.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 3 [Fragaria vesca subsp. vesca] gi|470142693|ref|XP_004307037.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 4 [Fragaria vesca subsp. vesca] Length = 119 Score = 100 bits (248), Expect = 3e-19 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKN+ PEE+L C+TRLRNSLGRKVVKL TRHVTKHPSVQGTWTTD+K Sbjct: 67 ERVVCVKNMDPEEVLQCATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTDIK 118 >ref|XP_004307034.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 1 [Fragaria vesca subsp. vesca] Length = 124 Score = 100 bits (248), Expect = 3e-19 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKN+ PEE+L C+TRLRNSLGRKVVKL TRHVTKHPSVQGTWTTD+K Sbjct: 72 ERVVCVKNMDPEEVLQCATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTDIK 123 >gb|EMJ27055.1| hypothetical protein PRUPE_ppa013515mg [Prunus persica] Length = 119 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKN+ PEE+L +TRLRNSLGRKVVKL TRHVTKHPSVQGTWTTD+K Sbjct: 67 ERVVCVKNMDPEEVLQYATRLRNSLGRKVVKLKTRHVTKHPSVQGTWTTDVK 118 >ref|XP_004985267.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Setaria italica] Length = 119 Score = 93.2 bits (230), Expect = 3e-17 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLKL 306 ERVVCV+NL PE+IL+ +TRLRNSLGRKVVKL TRHVTK PSVQGTWTTDLK+ Sbjct: 67 ERVVCVRNLPPEDILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTDLKM 119 >gb|EOY04682.1| Mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Theobroma cacao] Length = 119 Score = 92.8 bits (229), Expect = 4e-17 Identities = 41/52 (78%), Positives = 50/52 (96%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERV+CVKN++PE+IL+ ++RLRN+LGRKVVKL TRHVTKHPSVQGTWTTD+K Sbjct: 67 ERVICVKNMTPEDILLHASRLRNALGRKVVKLKTRHVTKHPSVQGTWTTDVK 118 >ref|NP_191524.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] gi|6996301|emb|CAB75462.1| putative protein [Arabidopsis thaliana] gi|21617971|gb|AAM67021.1| unknown [Arabidopsis thaliana] gi|27808540|gb|AAO24550.1| At3g59650 [Arabidopsis thaliana] gi|110743592|dbj|BAE99633.1| hypothetical protein [Arabidopsis thaliana] gi|332646429|gb|AEE79950.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] Length = 119 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKN+ PEE+L+ +TRLRNSLGRKVVKL TRHVTKHPSVQGTWTT +K Sbjct: 67 ERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTAVK 118 >ref|NP_001190137.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] gi|332646430|gb|AEE79951.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] Length = 146 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKN+ PEE+L+ +TRLRNSLGRKVVKL TRHVTKHPSVQGTWTT +K Sbjct: 94 ERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTAVK 145 >ref|XP_002876517.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis lyrata subsp. lyrata] gi|565468360|ref|XP_006292060.1| hypothetical protein CARUB_v10018255mg [Capsella rubella] gi|297322355|gb|EFH52776.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis lyrata subsp. lyrata] gi|482560767|gb|EOA24958.1| hypothetical protein CARUB_v10018255mg [Capsella rubella] Length = 119 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKN+ PEE+L+ +TRLRNSLGRKVVKL TRHVTKHPSVQGTWTT +K Sbjct: 67 ERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTAVK 118 >ref|XP_002465669.1| hypothetical protein SORBIDRAFT_01g043440 [Sorghum bicolor] gi|241919523|gb|EER92667.1| hypothetical protein SORBIDRAFT_01g043440 [Sorghum bicolor] Length = 119 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLKL 306 ERVVCV+NL PEEIL+ +TRLRNSLGRKVVKL TRHVTK PSVQGTWTT+LK+ Sbjct: 67 ERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM 119 >ref|XP_002438166.1| hypothetical protein SORBIDRAFT_10g009060 [Sorghum bicolor] gi|241916389|gb|EER89533.1| hypothetical protein SORBIDRAFT_10g009060 [Sorghum bicolor] gi|414865320|tpg|DAA43877.1| TPA: ribosomal protein L43 isoform 1 [Zea mays] gi|414865321|tpg|DAA43878.1| TPA: ribosomal protein L43 isoform 2 [Zea mays] Length = 119 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLKL 306 ERVVCV+NL PEEIL+ +TRLRNSLGRKVVKL TRHVTK PSVQGTWTT+LK+ Sbjct: 67 ERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM 119 >tpg|DAA43879.1| TPA: hypothetical protein ZEAMMB73_621483 [Zea mays] Length = 90 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLKL 306 ERVVCV+NL PEEIL+ +TRLRNSLGRKVVKL TRHVTK PSVQGTWTT+LK+ Sbjct: 38 ERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM 90 >ref|NP_001130710.1| hypothetical protein [Zea mays] gi|194689906|gb|ACF79037.1| unknown [Zea mays] gi|413956633|gb|AFW89282.1| hypothetical protein ZEAMMB73_180611 [Zea mays] Length = 119 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLKL 306 ERVVCV+NL PEEIL+ +TRLRNSLGRKVVKL TRHVTK PSVQGTWTT+LK+ Sbjct: 67 ERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM 119 >ref|XP_006856003.1| hypothetical protein AMTR_s00059p00033240 [Amborella trichopoda] gi|548859862|gb|ERN17470.1| hypothetical protein AMTR_s00059p00033240 [Amborella trichopoda] Length = 119 Score = 92.4 bits (228), Expect = 5e-17 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKN+ PE+IL+ +TRLRN+LGRKV+KL TRHVTKHPSVQGTWT DLK Sbjct: 67 ERVVCVKNMKPEDILLHATRLRNALGRKVIKLRTRHVTKHPSVQGTWTKDLK 118 >ref|NP_001173310.1| Os03g0207250 [Oryza sativa Japonica Group] gi|26006491|gb|AAN77300.1| Unknown protein [Oryza sativa Japonica Group] gi|108706764|gb|ABF94559.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein, putative, expressed [Oryza sativa Japonica Group] gi|108706765|gb|ABF94560.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein, putative, expressed [Oryza sativa Japonica Group] gi|125542835|gb|EAY88974.1| hypothetical protein OsI_10460 [Oryza sativa Indica Group] gi|125585334|gb|EAZ25998.1| hypothetical protein OsJ_09851 [Oryza sativa Japonica Group] gi|215768870|dbj|BAH01099.1| unnamed protein product [Oryza sativa Japonica Group] gi|255674301|dbj|BAH92038.1| Os03g0207250 [Oryza sativa Japonica Group] Length = 119 Score = 92.4 bits (228), Expect = 5e-17 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLKL 306 ERVVCV+NL+PE+IL+ +TRLRNSLGRKVVKL TRHVTK PSVQGTWTT+LK+ Sbjct: 67 ERVVCVRNLAPEDILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM 119 >ref|XP_006649598.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Oryza brachyantha] Length = 119 Score = 91.7 bits (226), Expect = 9e-17 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLKL 306 ERVVCV+NL PE+IL+ +TRLRNSLGRKVVKL TRHVTK PSVQGTWTT+LK+ Sbjct: 67 ERVVCVRNLPPEDILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM 119 >gb|AFK38190.1| unknown [Medicago truncatula] Length = 119 Score = 91.7 bits (226), Expect = 9e-17 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 +RVVCVKN+ PEEIL+ +TRLRN+LGRKV+KL TRHVTKHPSVQGTWTT LK Sbjct: 67 DRVVCVKNMDPEEILLHATRLRNALGRKVIKLRTRHVTKHPSVQGTWTTALK 118 >ref|NP_001148774.1| LOC100282391 [Zea mays] gi|195622062|gb|ACG32861.1| mitochondrial ribosomal protein L43 [Zea mays] Length = 119 Score = 91.7 bits (226), Expect = 9e-17 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLKL 306 ERVVCV+NL PEEIL+ +T+LRNSLGRKVVKL TRHVTK PSVQGTWTT+LK+ Sbjct: 67 ERVVCVRNLPPEEILLQATKLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM 119 >ref|XP_003627415.1| Mitochondrial ribosomal protein L43 [Medicago truncatula] gi|355521437|gb|AET01891.1| Mitochondrial ribosomal protein L43 [Medicago truncatula] Length = 119 Score = 91.7 bits (226), Expect = 9e-17 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 +RVVCVKN+ PEEIL+ +TRLRN+LGRKV+KL TRHVTKHPSVQGTWTT LK Sbjct: 67 DRVVCVKNMDPEEILLHATRLRNALGRKVIKLRTRHVTKHPSVQGTWTTALK 118 >ref|XP_006402670.1| hypothetical protein EUTSA_v10006316mg [Eutrema salsugineum] gi|567183389|ref|XP_006402671.1| hypothetical protein EUTSA_v10006316mg [Eutrema salsugineum] gi|557103769|gb|ESQ44123.1| hypothetical protein EUTSA_v10006316mg [Eutrema salsugineum] gi|557103770|gb|ESQ44124.1| hypothetical protein EUTSA_v10006316mg [Eutrema salsugineum] Length = 119 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKN+ PEE+L+ +TRLRNSLGRKVVKL TRHVTK+PSVQGTWTT +K Sbjct: 67 ERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRTRHVTKYPSVQGTWTTAIK 118 >ref|XP_002530576.1| 60S ribosomal protein L51, putative [Ricinus communis] gi|223529875|gb|EEF31806.1| 60S ribosomal protein L51, putative [Ricinus communis] Length = 119 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/52 (78%), Positives = 49/52 (94%) Frame = -1 Query: 464 ERVVCVKNLSPEEILMCSTRLRNSLGRKVVKLSTRHVTKHPSVQGTWTTDLK 309 ERVVCVKNL+P+E+L+ +TRLRNSLGRKVVKL TRHVT+HPSVQGTWTT ++ Sbjct: 67 ERVVCVKNLTPDEVLLQATRLRNSLGRKVVKLKTRHVTQHPSVQGTWTTAVR 118