BLASTX nr result
ID: Catharanthus23_contig00008935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00008935 (505 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525601.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002525601.1| conserved hypothetical protein [Ricinus communis] gi|223535037|gb|EEF36719.1| conserved hypothetical protein [Ricinus communis] Length = 110 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = +3 Query: 351 SMHPLYKQRK--EKCTLPTQALSCSGSKGLSQPDLASHCT 464 S HP+ +Q+K KCTLPTQALSCSGSKGLSQPDL + T Sbjct: 20 SCHPVQEQKKWKRKCTLPTQALSCSGSKGLSQPDLLNPLT 59