BLASTX nr result
ID: Catharanthus23_contig00006198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00006198 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63230.1| hypothetical protein M569_11557 [Genlisea aurea] 62 1e-07 gb|EOY08940.1| Uncharacterized protein TCM_024233 [Theobroma cacao] 56 6e-06 >gb|EPS63230.1| hypothetical protein M569_11557 [Genlisea aurea] Length = 607 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/32 (84%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -2 Query: 315 VNAAQGFHR-QNDPYSNTYNPGWRNHPNFSWR 223 VNAA G R +NDPYSNTYNPGWRNHPNFSWR Sbjct: 211 VNAATGPSRYKNDPYSNTYNPGWRNHPNFSWR 242 >gb|EOY08940.1| Uncharacterized protein TCM_024233 [Theobroma cacao] Length = 148 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -2 Query: 315 VNAAQGFHRQNDPYSNTYNPGWRNHPNFSW 226 V+A QN+PYSNTYNPGW+NHPNFSW Sbjct: 11 VDAFSALSTQNNPYSNTYNPGWKNHPNFSW 40