BLASTX nr result
ID: Catharanthus23_contig00005915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00005915 (1823 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18929.3| unnamed protein product [Vitis vinifera] 116 4e-23 ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containi... 116 4e-23 ref|XP_002301973.2| pentatricopeptide repeat-containing family p... 115 6e-23 gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protei... 115 6e-23 ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutr... 114 1e-22 ref|NP_173449.1| pentatricopeptide repeat-containing protein [Ar... 112 4e-22 ref|XP_002890375.1| pentatricopeptide repeat-containing protein ... 112 4e-22 gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] 112 7e-22 ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Caps... 112 7e-22 gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] 110 2e-21 ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-20 ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containi... 106 3e-20 ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containi... 106 4e-20 ref|XP_006655248.1| PREDICTED: pentatricopeptide repeat-containi... 105 7e-20 ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containi... 105 7e-20 ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-19 ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-19 gb|EOY10338.1| Tetratricopeptide repeat (TPR)-like superfamily p... 104 1e-19 gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] 104 1e-19 ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-19 >emb|CBI18929.3| unnamed protein product [Vitis vinifera] Length = 387 Score = 116 bits (290), Expect = 4e-23 Identities = 52/69 (75%), Positives = 55/69 (79%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++FGLLNT PG PL V+KNLRICGDCH VIKFIS FE REIFVRDT RFH FKE Sbjct: 319 HSEKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDTNRFHHFKE 378 Query: 626 GVCSCGDVW 600 G CSCGD W Sbjct: 379 GACSCGDYW 387 >ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] Length = 758 Score = 116 bits (290), Expect = 4e-23 Identities = 52/69 (75%), Positives = 55/69 (79%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++FGLLNT PG PL V+KNLRICGDCH VIKFIS FE REIFVRDT RFH FKE Sbjct: 690 HSEKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDTNRFHHFKE 749 Query: 626 GVCSCGDVW 600 G CSCGD W Sbjct: 750 GACSCGDYW 758 >ref|XP_002301973.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344115|gb|EEE81246.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 724 Score = 115 bits (288), Expect = 6e-23 Identities = 53/69 (76%), Positives = 57/69 (82%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++ GLLNTKPG PL V+KNLRIC DCHAVIKFIS FE+REIFVRDT RFHQFK Sbjct: 656 HSEKLAVVLGLLNTKPGFPLQVIKNLRICRDCHAVIKFISDFEKREIFVRDTNRFHQFKG 715 Query: 626 GVCSCGDVW 600 GVCSCGD W Sbjct: 716 GVCSCGDYW 724 >gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 758 Score = 115 bits (288), Expect = 6e-23 Identities = 51/69 (73%), Positives = 57/69 (82%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L + FGLLNT PG+PL ++KNLRICGDCHAVIKFISGFE REI+VRDT RFH FK+ Sbjct: 690 HSEKLAVAFGLLNTPPGSPLQIIKNLRICGDCHAVIKFISGFEGREIYVRDTNRFHHFKD 749 Query: 626 GVCSCGDVW 600 GVCSC D W Sbjct: 750 GVCSCRDYW 758 >ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] gi|557094189|gb|ESQ34771.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] Length = 760 Score = 114 bits (285), Expect = 1e-22 Identities = 50/69 (72%), Positives = 57/69 (82%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++FGLLNT GTPL V+KNLRICGDCH+VIKFISG+ REIFVRDT RFH FK+ Sbjct: 692 HSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHSVIKFISGYAGREIFVRDTNRFHHFKD 751 Query: 626 GVCSCGDVW 600 G+CSCGD W Sbjct: 752 GICSCGDFW 760 >ref|NP_173449.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806503|sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gi|332191832|gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 760 Score = 112 bits (281), Expect = 4e-22 Identities = 49/69 (71%), Positives = 56/69 (81%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++FGLLNT GTPL V+KNLRICGDCHAVIKFIS + REIF+RDT RFH FK+ Sbjct: 692 HSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFKD 751 Query: 626 GVCSCGDVW 600 G+CSCGD W Sbjct: 752 GICSCGDFW 760 >ref|XP_002890375.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336217|gb|EFH66634.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 760 Score = 112 bits (281), Expect = 4e-22 Identities = 49/69 (71%), Positives = 56/69 (81%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++FGLLNT GTPL V+KNLRICGDCHAVIKFIS + REIF+RDT RFH FK+ Sbjct: 692 HSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFKD 751 Query: 626 GVCSCGDVW 600 G+CSCGD W Sbjct: 752 GICSCGDFW 760 >gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] Length = 728 Score = 112 bits (279), Expect = 7e-22 Identities = 50/69 (72%), Positives = 55/69 (79%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L + FGLLNT PG+ L V+KNLRICGDCH VIKFIS FE+REIFVRDT RFH FK+ Sbjct: 660 HSEKLAVAFGLLNTPPGSSLRVIKNLRICGDCHVVIKFISSFEQREIFVRDTNRFHHFKD 719 Query: 626 GVCSCGDVW 600 G CSCGD W Sbjct: 720 GHCSCGDYW 728 >ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] gi|482575552|gb|EOA39739.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] Length = 760 Score = 112 bits (279), Expect = 7e-22 Identities = 49/69 (71%), Positives = 56/69 (81%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++FGLLNT GTPL V+KNLRICGDCH+VIKFIS + REIFVRDT RFH FK+ Sbjct: 692 HSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHSVIKFISSYAGREIFVRDTNRFHHFKD 751 Query: 626 GVCSCGDVW 600 G+CSCGD W Sbjct: 752 GICSCGDFW 760 >gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] Length = 1063 Score = 110 bits (275), Expect = 2e-21 Identities = 48/69 (69%), Positives = 56/69 (81%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++FG+LNT G+P+ V KNLRICGDCHAVIKFISGFE REI VRDT R+H FK+ Sbjct: 995 HSEKLAVVFGILNTSRGSPIRVTKNLRICGDCHAVIKFISGFEGREISVRDTNRYHHFKD 1054 Query: 626 GVCSCGDVW 600 G+CSCGD W Sbjct: 1055 GICSCGDYW 1063 >ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Brachypodium distachyon] Length = 661 Score = 107 bits (268), Expect = 1e-20 Identities = 46/72 (63%), Positives = 56/72 (77%) Frame = -1 Query: 815 IKMHPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQ 636 + +H L + GL++T+PGTPL V+KNLRICGDCH +KFIS FE+REI VRDT RFH Sbjct: 590 LAVHSEKLAVALGLISTRPGTPLRVIKNLRICGDCHEAMKFISSFEQREISVRDTNRFHH 649 Query: 635 FKEGVCSCGDVW 600 FK+G CSCGD W Sbjct: 650 FKDGKCSCGDYW 661 >ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Fragaria vesca subsp. vesca] Length = 755 Score = 106 bits (265), Expect = 3e-20 Identities = 48/69 (69%), Positives = 54/69 (78%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++ GLLNT PG+ L V+KNLRICGDCH+VIKFIS E REI VRDT RFH FK+ Sbjct: 687 HSEKLAVVLGLLNTPPGSSLRVIKNLRICGDCHSVIKFISSLEGREISVRDTNRFHHFKD 746 Query: 626 GVCSCGDVW 600 GVCSCGD W Sbjct: 747 GVCSCGDYW 755 >ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like isoform X1 [Glycine max] Length = 748 Score = 106 bits (264), Expect = 4e-20 Identities = 48/69 (69%), Positives = 53/69 (76%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++ GLLNT PG PL V+KNLRIC DCHAVIK IS E REI+VRDT RFH FK+ Sbjct: 680 HSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDTNRFHHFKD 739 Query: 626 GVCSCGDVW 600 GVCSCGD W Sbjct: 740 GVCSCGDFW 748 >ref|XP_006655248.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Oryza brachyantha] Length = 584 Score = 105 bits (262), Expect = 7e-20 Identities = 45/72 (62%), Positives = 54/72 (75%) Frame = -1 Query: 815 IKMHPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQ 636 + +H L + GL++T GTP+ V+KNLRICGDCH IKFIS FEEREI+VRDT RFH Sbjct: 513 LSVHSEKLAVALGLISTSQGTPIRVIKNLRICGDCHEAIKFISSFEEREIYVRDTNRFHH 572 Query: 635 FKEGVCSCGDVW 600 FK+G CSC D W Sbjct: 573 FKDGKCSCADYW 584 >ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 828 Score = 105 bits (262), Expect = 7e-20 Identities = 45/69 (65%), Positives = 52/69 (75%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++ G+LNT PGT L V+KNLRICGDCH IKFIS FE REI+VRD R+H F E Sbjct: 760 HSEKLAVVLGILNTNPGTSLRVIKNLRICGDCHTFIKFISSFEGREIYVRDANRYHHFNE 819 Query: 626 GVCSCGDVW 600 G+CSCGD W Sbjct: 820 GICSCGDYW 828 >ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 104 bits (260), Expect = 1e-19 Identities = 45/69 (65%), Positives = 50/69 (72%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L I FGL+ T PGTP+ V KNLR+CGDCH IKFIS E+REI VRDT RFH F+ Sbjct: 599 HSEKLAIAFGLMKTAPGTPIRVFKNLRVCGDCHRAIKFISAIEKREIIVRDTTRFHHFRN 658 Query: 626 GVCSCGDVW 600 G CSCGD W Sbjct: 659 GFCSCGDYW 667 >ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 104 bits (260), Expect = 1e-19 Identities = 45/69 (65%), Positives = 50/69 (72%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L I FGL+ T PGTP+ V KNLR+CGDCH IKFIS E+REI VRDT RFH F+ Sbjct: 599 HSEKLAIAFGLMKTAPGTPIRVFKNLRVCGDCHRAIKFISAIEKREIIVRDTTRFHHFRN 658 Query: 626 GVCSCGDVW 600 G CSCGD W Sbjct: 659 GFCSCGDYW 667 >gb|EOY10338.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 889 Score = 104 bits (259), Expect = 1e-19 Identities = 46/69 (66%), Positives = 52/69 (75%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L I FGLLNTKPGTPL ++KNLR+CGDCH V K+IS +REI VRD RFH FK Sbjct: 821 HSERLAIAFGLLNTKPGTPLHIMKNLRVCGDCHTVTKYISMIMQREILVRDANRFHIFKN 880 Query: 626 GVCSCGDVW 600 G+CSCGD W Sbjct: 881 GICSCGDHW 889 >gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] Length = 662 Score = 104 bits (259), Expect = 1e-19 Identities = 46/72 (63%), Positives = 54/72 (75%) Frame = -1 Query: 815 IKMHPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQ 636 + +H L + GL++T PGTPL V+KNLRICGDCH +KFIS FE REI VRDT RFH Sbjct: 591 LAVHSEKLAVALGLISTSPGTPLRVIKNLRICGDCHEAMKFISCFEGREISVRDTNRFHH 650 Query: 635 FKEGVCSCGDVW 600 FK+G CSCGD W Sbjct: 651 FKDGKCSCGDYW 662 >ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 601 Score = 103 bits (258), Expect = 2e-19 Identities = 47/69 (68%), Positives = 52/69 (75%) Frame = -1 Query: 806 HPNFLNILFGLLNTKPGTPLTVLKNLRICGDCHAVIKFISGFEEREIFVRDTARFHQFKE 627 H L ++ GLLNT PG PL V+KNLRIC DCHAVIK IS E REI+VRDT R H FK+ Sbjct: 533 HSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDTNRLHHFKD 592 Query: 626 GVCSCGDVW 600 GVCSCGD W Sbjct: 593 GVCSCGDFW 601