BLASTX nr result
ID: Catharanthus23_contig00005272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00005272 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9AR73.1|HQGT_RAUSE RecName: Full=Hydroquinone glucosyltransf... 60 4e-07 gb|EXB62213.1| Hydroquinone glucosyltransferase [Morus notabilis] 58 1e-06 >sp|Q9AR73.1|HQGT_RAUSE RecName: Full=Hydroquinone glucosyltransferase; AltName: Full=Arbutin synthase gi|13508844|emb|CAC35167.1| arbutin synthase [Rauvolfia serpentina] Length = 470 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 2 RSIMKDLKDYASKALSEDGSSTKALDELASRWKNKICTT 118 RS MKDLKD AS+ALS+DGSSTKAL ELA +W+NKI +T Sbjct: 432 RSTMKDLKDAASRALSDDGSSTKALAELACKWENKISST 470 >gb|EXB62213.1| Hydroquinone glucosyltransferase [Morus notabilis] Length = 480 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 RSIMKDLKDYASKALSEDGSSTKALDELASRWKNKIC 112 R+ MKDLK+ ASKALSEDG STKAL E+A +WKN+IC Sbjct: 443 RNRMKDLKEAASKALSEDGDSTKALTEVADKWKNQIC 479