BLASTX nr result
ID: Catharanthus23_contig00004996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00004996 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY02523.1| Aldose 1-epimerase family protein isoform 1 [Theo... 69 9e-10 ref|XP_006287951.1| hypothetical protein CARUB_v10001186mg, part... 59 7e-07 emb|CAB87789.1| putative protein [Arabidopsis thaliana] 59 9e-07 >gb|EOY02523.1| Aldose 1-epimerase family protein isoform 1 [Theobroma cacao] Length = 351 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -3 Query: 149 LEWRKGKVHPFVSKFRAKFQSKTMHPNMIIDADGNSRVILTEPTGSTAE 3 LEWRKGKV+PFVS RA+ + K M N++ DADG R+ILTEPTGS+AE Sbjct: 23 LEWRKGKVNPFVSSIRARLRPKAMPLNIVRDADGLPRIILTEPTGSSAE 71 >ref|XP_006287951.1| hypothetical protein CARUB_v10001186mg, partial [Capsella rubella] gi|482556657|gb|EOA20849.1| hypothetical protein CARUB_v10001186mg, partial [Capsella rubella] Length = 378 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -3 Query: 149 LEWRKGKVHPFVSKFRAKFQSKTMHPNMIIDADGNSRVILTEPTGSTAE 3 LEW+KGK +PFV R++ + K M N++ D DG+SR++LT+P GSTAE Sbjct: 50 LEWKKGKGNPFVRGIRSRLKPKPMPLNVVNDRDGSSRILLTDPGGSTAE 98 >emb|CAB87789.1| putative protein [Arabidopsis thaliana] Length = 381 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -3 Query: 149 LEWRKGKVHPFVSKFRAKF-QSKTMHPNMIIDADGNSRVILTEPTGSTAE 3 LEW+KGKV+PFV R++ + K+M N++ D DG+SR++LT+P GSTAE Sbjct: 51 LEWKKGKVNPFVRGIRSRLIRPKSMPLNVVNDRDGSSRILLTDPAGSTAE 100