BLASTX nr result
ID: Catharanthus23_contig00004934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00004934 (474 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38971.1| Copper transporter 5 [Morus notabilis] 55 1e-05 >gb|EXB38971.1| Copper transporter 5 [Morus notabilis] Length = 142 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/50 (48%), Positives = 30/50 (60%) Frame = +3 Query: 324 MMHMTMYWSRSVTFLLDSWKTESWQXXXXXXXXXXXXXXXHQRLEAQRFR 473 MMHMT+YWS++VT L+DSWKT+SW HQ LE +R R Sbjct: 1 MMHMTLYWSKAVTLLIDSWKTDSWTSYLLTLLACFLVSAFHQYLEDRRIR 50