BLASTX nr result
ID: Catharanthus23_contig00003861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00003861 (641 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520369.1| 4-hydroxyphenylpyruvate dioxygenase, putativ... 55 8e-06 >ref|XP_002520369.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Ricinus communis] gi|223540416|gb|EEF41985.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Ricinus communis] Length = 441 Score = 54.7 bits (130), Expect(2) = 8e-06 Identities = 33/55 (60%), Positives = 36/55 (65%), Gaps = 5/55 (9%) Frame = -1 Query: 608 IIQRVGCMLK-----EYQXXXXXXXXXGNFSELFKSIQE*EKMLEANQVVETATA 459 IIQRVGCMLK EYQ GNFSELFKSI+E EK LEA +V E A+A Sbjct: 387 IIQRVGCMLKDDAGKEYQKGGCGGFGKGNFSELFKSIEEFEKTLEARRVTEAASA 441 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 639 TKLIGDRPTI 610 TK +GDRPTI Sbjct: 374 TKPVGDRPTI 383