BLASTX nr result
ID: Catharanthus23_contig00003815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00003815 (5298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006365217.1| PREDICTED: RNA-binding protein 25-like isofo... 61 6e-06 >ref|XP_006365217.1| PREDICTED: RNA-binding protein 25-like isoform X4 [Solanum tuberosum] Length = 948 Score = 60.8 bits (146), Expect = 6e-06 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 4857 KLQGILNEEAEMFVLKMWRMLIFEIKRVETGY 4762 +LQ IL+EEAEMFVLKMWRMLIFEIK+VETGY Sbjct: 902 RLQSILDEEAEMFVLKMWRMLIFEIKKVETGY 933