BLASTX nr result
ID: Catharanthus23_contig00003707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00003707 (239 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002866078.1| F-box family protein [Arabidopsis lyrata sub... 60 3e-07 ref|NP_200326.2| uncharacterized protein [Arabidopsis thaliana] ... 59 5e-07 dbj|BAB08584.1| unnamed protein product [Arabidopsis thaliana] 59 5e-07 >ref|XP_002866078.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297311913|gb|EFH42337.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 375 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = -2 Query: 202 FVTKAVVSRNPRDDVKGKWVIVAIYGQFRILGFAREGDKVWTDIPCPSRCYDDVVFYEGK 23 FV KAV S + DD +WV++ IY R L F R GDK WTD+ + DD+VF G Sbjct: 151 FVKKAVSSTSLLDD---EWVVLVIYNTDRKLAFCRRGDKQWTDLESVASAVDDIVFCNGV 207 Query: 22 FYAVD 8 F+A+D Sbjct: 208 FFAID 212 >ref|NP_200326.2| uncharacterized protein [Arabidopsis thaliana] gi|142991284|sp|Q9FLP7.2|FB294_ARATH RecName: Full=Putative F-box protein At5g55150 gi|332009209|gb|AED96592.1| uncharacterized protein AT5G55150 [Arabidopsis thaliana] Length = 360 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 202 FVTKAVVSRNPRDDVKGKWVIVAIYGQFRILGFAREGDKVWTDIPCPSRCYDDVVFYEGK 23 F+ KAV S + DD +WV++ IY R L F R GDK WTD+ + DD+VF G Sbjct: 139 FIKKAVSSTSLLDD---EWVVLVIYNTDRKLAFCRRGDKQWTDLESVASSVDDIVFCNGV 195 Query: 22 FYAVD 8 F+A+D Sbjct: 196 FFAID 200 >dbj|BAB08584.1| unnamed protein product [Arabidopsis thaliana] Length = 340 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 202 FVTKAVVSRNPRDDVKGKWVIVAIYGQFRILGFAREGDKVWTDIPCPSRCYDDVVFYEGK 23 F+ KAV S + DD +WV++ IY R L F R GDK WTD+ + DD+VF G Sbjct: 119 FIKKAVSSTSLLDD---EWVVLVIYNTDRKLAFCRRGDKQWTDLESVASSVDDIVFCNGV 175 Query: 22 FYAVD 8 F+A+D Sbjct: 176 FFAID 180