BLASTX nr result
ID: Catharanthus23_contig00003555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00003555 (1621 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38561.1| hypothetical protein L484_008589 [Morus notabilis] 63 3e-07 gb|EXB55785.1| hypothetical protein L484_001590 [Morus notabilis] 60 4e-06 gb|EXB55788.1| hypothetical protein L484_001593 [Morus notabilis] 59 6e-06 >gb|EXB38561.1| hypothetical protein L484_008589 [Morus notabilis] Length = 163 Score = 63.2 bits (152), Expect = 3e-07 Identities = 34/91 (37%), Positives = 55/91 (60%), Gaps = 1/91 (1%) Frame = -1 Query: 1621 LLLSFCF-AAMSMASQILSTGTPNHLPLSFHMAGLGVVFSLSAFVLCKYIPAVRMRREAL 1445 ++L+ CF AA+ +A L + L +SF + L ++F+ S F + ++ A + + A Sbjct: 56 IMLAVCFSAAIDIAIPSLQIQS-QLLHISFSLVSLALLFAFSTFFMSMFLAAYKFTQAAR 114 Query: 1444 FLENMGVFFGITAFFLDITIFFPLCLKDLPW 1352 FLE GVFF +T FF+ I+I FPLCL+ + W Sbjct: 115 FLERAGVFFVVTGFFIVISIRFPLCLRVVTW 145 >gb|EXB55785.1| hypothetical protein L484_001590 [Morus notabilis] Length = 133 Score = 59.7 bits (143), Expect = 4e-06 Identities = 30/89 (33%), Positives = 52/89 (58%) Frame = -1 Query: 1618 LLSFCFAAMSMASQILSTGTPNHLPLSFHMAGLGVVFSLSAFVLCKYIPAVRMRREALFL 1439 LL CF A SMA ++S + +P + H+ LG++F+ ++F + K++ ++ A L Sbjct: 31 LLPVCFGA-SMAISMMSIQARSEIPTTVHLVSLGIMFAAASFFVSKFV-VLKFPMAAHVL 88 Query: 1438 ENMGVFFGITAFFLDITIFFPLCLKDLPW 1352 E +GVF +TAFF +++ PLC + W Sbjct: 89 ERVGVFVMVTAFFAAMSVPLPLCFRATTW 117 >gb|EXB55788.1| hypothetical protein L484_001593 [Morus notabilis] Length = 166 Score = 58.9 bits (141), Expect = 6e-06 Identities = 30/89 (33%), Positives = 52/89 (58%) Frame = -1 Query: 1618 LLSFCFAAMSMASQILSTGTPNHLPLSFHMAGLGVVFSLSAFVLCKYIPAVRMRREALFL 1439 LL CF A SMA ++S + +P + H+ LG++F+ ++F + K++ ++ A L Sbjct: 31 LLPVCFGA-SMAISMVSIQARSEIPSTVHLVSLGIMFAAASFFVSKFV-VLKFPMAAHVL 88 Query: 1438 ENMGVFFGITAFFLDITIFFPLCLKDLPW 1352 E +GVF +TAFF +++ PLC + W Sbjct: 89 ERVGVFVMVTAFFAAMSVPLPLCFRATTW 117