BLASTX nr result
ID: Catharanthus23_contig00001794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00001794 (957 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302141.2| hypothetical protein POPTR_0002s06010g [Popu... 62 3e-07 >ref|XP_002302141.2| hypothetical protein POPTR_0002s06010g [Populus trichocarpa] gi|566156476|ref|XP_006386284.1| hypothetical protein POPTR_0002s06010g [Populus trichocarpa] gi|550344374|gb|EEE81414.2| hypothetical protein POPTR_0002s06010g [Populus trichocarpa] gi|550344375|gb|ERP64081.1| hypothetical protein POPTR_0002s06010g [Populus trichocarpa] Length = 390 Score = 62.0 bits (149), Expect = 3e-07 Identities = 41/102 (40%), Positives = 52/102 (50%), Gaps = 6/102 (5%) Frame = -1 Query: 615 MDEPLIFKKAAAAETSNRAPSPR------YININPSRQQTNYVFVNGDTLTSPSKTPNSP 454 MDEP + K A E S PSPR Y+++ S +Q+ V D + TPN+ Sbjct: 1 MDEPFL-SKTIAEEISR--PSPRREHPSNYLDLGQSLRQSTAHLVTNDVIIPIITTPNTS 57 Query: 453 XXXXXXXXXXXXKTRLTGRSHSAPSVLTDTKEEFCDSLEPRR 328 KTRL RSHSAPSV TD+KE F DS +PR+ Sbjct: 58 SFVNLIANLNKEKTRLAHRSHSAPSVFTDSKESFTDSFDPRQ 99