BLASTX nr result
ID: Catharanthus22_contig00032267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00032267 (299 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002879249.1| ubiquitin family protein [Arabidopsis lyrata... 59 9e-07 ref|NP_001189636.1| uncharacterized protein [Arabidopsis thalian... 57 3e-06 pdb|2KD0|A Chain A, Nmr Solution Structure Of O64736 Protein Fro... 57 3e-06 sp|P0C895.1|Y2010_ARATH RecName: Full=LRR repeats and ubiquitin-... 57 3e-06 gb|AAC16962.1| putative unknown protein, leucine-rich repeat [Ar... 57 3e-06 >ref|XP_002879249.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] gi|297325088|gb|EFH55508.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] Length = 900 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = +1 Query: 154 IRVNVKLGGRYVPFEISSDCTVKEFKNFLIRFSNDFPRGQRLIFKGRI 297 I++ VK GG+ +P +S DCTVK+ K+ L +N PRGQ+LIFKG++ Sbjct: 539 IKLTVKFGGKSIPLSVSQDCTVKDLKSLLQPITNVLPRGQKLIFKGKV 586 >ref|NP_001189636.1| uncharacterized protein [Arabidopsis thaliana] gi|330253251|gb|AEC08345.1| uncharacterized protein AT2G30105 [Arabidopsis thaliana] Length = 367 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = +1 Query: 154 IRVNVKLGGRYVPFEISSDCTVKEFKNFLIRFSNDFPRGQRLIFKGRI 297 I++ VK GG+ +P +S DCTVK+ K+ L +N PRGQ+LIFKG++ Sbjct: 6 IKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKV 53 >pdb|2KD0|A Chain A, Nmr Solution Structure Of O64736 Protein From Arabidopsis Thaliana. Northeast Structural Genomics Consortium Mega Target Ar3445a Length = 85 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = +1 Query: 154 IRVNVKLGGRYVPFEISSDCTVKEFKNFLIRFSNDFPRGQRLIFKGRI 297 I++ VK GG+ +P +S DCTVK+ K+ L +N PRGQ+LIFKG++ Sbjct: 13 IKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKV 60 >sp|P0C895.1|Y2010_ARATH RecName: Full=LRR repeats and ubiquitin-like domain-containing protein At2g30105 Length = 374 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = +1 Query: 154 IRVNVKLGGRYVPFEISSDCTVKEFKNFLIRFSNDFPRGQRLIFKGRI 297 I++ VK GG+ +P +S DCTVK+ K+ L +N PRGQ+LIFKG++ Sbjct: 13 IKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKV 60 >gb|AAC16962.1| putative unknown protein, leucine-rich repeat [Arabidopsis thaliana] Length = 902 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = +1 Query: 154 IRVNVKLGGRYVPFEISSDCTVKEFKNFLIRFSNDFPRGQRLIFKGRI 297 I++ VK GG+ +P +S DCTVK+ K+ L +N PRGQ+LIFKG++ Sbjct: 536 IKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKV 583