BLASTX nr result
ID: Bupleurum21_contig00039420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00039420 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08723.1| Polynucleotidyl transferase, Ribonuclease H fold ... 68 3e-12 ref|XP_003635424.1| PREDICTED: LOW QUALITY PROTEIN: putative rib... 72 4e-12 ref|XP_002518871.1| conserved hypothetical protein [Ricinus comm... 75 4e-12 ref|XP_002462405.1| hypothetical protein SORBIDRAFT_02g025125 [S... 74 9e-12 gb|EEC72938.1| hypothetical protein OsI_06800 [Oryza sativa Indi... 74 2e-11 >gb|ABN08723.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 355 Score = 67.8 bits (164), Expect(2) = 3e-12 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 1/88 (1%) Frame = -1 Query: 410 KSAYNLLQEG-NQHNMSSNSGFWTNMWNLKIPHKVKIFLWRAISDCLPTKEQLRIKHVNV 234 KSAY + + + H+ + N+ W N+WNL IPH+V+ FLWR +CLPT+ L + + Sbjct: 93 KSAYRICSDLLHPHDSAHNNSSWMNIWNLNIPHRVRAFLWRLAHNCLPTRVNLNARGIQC 152 Query: 233 NHLCPVCNFELETIMHTLVSCQFAQLCW 150 C + E H C A CW Sbjct: 153 EESCVMFENFAECHTHLFFVCAKAMDCW 180 Score = 28.5 bits (62), Expect(2) = 3e-12 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 67 NDQFTKVGMLAWSLWKNRN 11 + Q GML WSLWK+RN Sbjct: 212 SQQQQAAGMLLWSLWKSRN 230 >ref|XP_003635424.1| PREDICTED: LOW QUALITY PROTEIN: putative ribonuclease H protein At1g65750-like [Vitis vinifera] Length = 820 Score = 72.4 bits (176), Expect(2) = 4e-12 Identities = 31/71 (43%), Positives = 41/71 (57%) Frame = -1 Query: 347 WTNMWNLKIPHKVKIFLWRAISDCLPTKEQLRIKHVNVNHLCPVCNFELETIMHTLVSCQ 168 W +W + P K+ F WRA +CLPT+ L I+HV+ CP+C ELET +H LV C Sbjct: 508 WAQLWKVTAPPKILNFAWRAARNCLPTRFALTIRHVDTPMCCPICRSELETTLHALVECV 567 Query: 167 FAQLCWVRSEL 135 A+ W S L Sbjct: 568 AARDVWDESGL 578 Score = 23.5 bits (49), Expect(2) = 4e-12 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 58 FTKVGMLAWSLWKNRNEIV 2 F K + W LW RN++V Sbjct: 604 FAKYLAVCWGLWWRRNDVV 622 >ref|XP_002518871.1| conserved hypothetical protein [Ricinus communis] gi|223541858|gb|EEF43404.1| conserved hypothetical protein [Ricinus communis] Length = 668 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/87 (40%), Positives = 50/87 (57%) Frame = -1 Query: 410 KSAYNLLQEGNQHNMSSNSGFWTNMWNLKIPHKVKIFLWRAISDCLPTKEQLRIKHVNVN 231 K+ Y LLQ +S FW W LKIP KV+ +W+ S+C+ T LR+++V+++ Sbjct: 410 KNCYRLLQGDLGRPETS---FWNKFWKLKIPTKVRNLMWKICSNCIRTAMNLRMRYVDLD 466 Query: 230 HLCPVCNFELETIMHTLVSCQFAQLCW 150 LC CN E ET+ H L C A+ CW Sbjct: 467 PLCKWCNREPETLFHVLFGCSMARECW 493 >ref|XP_002462405.1| hypothetical protein SORBIDRAFT_02g025125 [Sorghum bicolor] gi|241925782|gb|EER98926.1| hypothetical protein SORBIDRAFT_02g025125 [Sorghum bicolor] Length = 457 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 6/97 (6%) Frame = -1 Query: 410 KSAYNLLQEGNQHNM------SSNSGFWTNMWNLKIPHKVKIFLWRAISDCLPTKEQLRI 249 KSAY L+ +G + S + W+ +W LK+P KVK+F WR + + LPT+ L Sbjct: 150 KSAYRLIDKGRTNGGHQEAVGGSGNSCWSEIWKLKVPPKVKVFWWRVLHEFLPTRLALHR 209 Query: 248 KHVNVNHLCPVCNFELETIMHTLVSCQFAQLCWVRSE 138 KH+ C C + E+I H L+ CQ A+ W +++ Sbjct: 210 KHIEPIANCDACGADSESIQHVLMECQIAKSFWEQTK 246 >gb|EEC72938.1| hypothetical protein OsI_06800 [Oryza sativa Indica Group] Length = 556 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 6/93 (6%) Frame = -1 Query: 410 KSAYNL------LQEGNQHNMSSNSGFWTNMWNLKIPHKVKIFLWRAISDCLPTKEQLRI 249 +SAY+L + EG+ + + NS W +W P KVKIF WRAI++ LPT E + Sbjct: 421 RSAYHLAIALAQVDEGSSSSGNGNSRAWNALWKCNAPQKVKIFAWRAITNSLPTLENKKK 480 Query: 248 KHVNVNHLCPVCNFELETIMHTLVSCQFAQLCW 150 + + V+ +C +C E E ++H L C A+ W Sbjct: 481 RKLEVSDICTICGVESEYVVHALFRCPHARQFW 513