BLASTX nr result
ID: Bupleurum21_contig00039341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00039341 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531106.1| nutrient reservoir, putative [Ricinus commun... 130 1e-28 ref|XP_002280191.1| PREDICTED: 12S seed storage globulin 1 [Viti... 127 7e-28 ref|XP_002531105.1| nutrient reservoir, putative [Ricinus commun... 127 1e-27 ref|XP_002310124.1| predicted protein [Populus trichocarpa] gi|2... 127 1e-27 ref|NP_172255.1| cupin domain-containing protein [Arabidopsis th... 126 2e-27 >ref|XP_002531106.1| nutrient reservoir, putative [Ricinus communis] gi|223529302|gb|EEF31271.1| nutrient reservoir, putative [Ricinus communis] Length = 358 Score = 130 bits (327), Expect = 1e-28 Identities = 60/76 (78%), Positives = 70/76 (92%) Frame = -3 Query: 230 EMELDFSPKLAKQVYGGNGGSYHAWCPNDLPMLREANIAAAKLCLEKNGFALPKYSDSPK 51 +ME+D SP+LAK+VYGG+GGSYHAWCP++L MLRE NI AAKL LEK+GFALP+YSDS K Sbjct: 2 KMEIDLSPRLAKKVYGGDGGSYHAWCPSELAMLREGNIGAAKLALEKDGFALPRYSDSAK 61 Query: 50 VAYVLQGSGVAGIVLP 3 VAYVLQG+GVAGIVLP Sbjct: 62 VAYVLQGNGVAGIVLP 77 >ref|XP_002280191.1| PREDICTED: 12S seed storage globulin 1 [Vitis vinifera] gi|297739302|emb|CBI28953.3| unnamed protein product [Vitis vinifera] Length = 356 Score = 127 bits (320), Expect = 7e-28 Identities = 60/75 (80%), Positives = 68/75 (90%) Frame = -3 Query: 227 MELDFSPKLAKQVYGGNGGSYHAWCPNDLPMLREANIAAAKLCLEKNGFALPKYSDSPKV 48 MELD SPKLAK+++G NGGSY AWCP++LPMLRE NI A+KL LEK+GFALP+YSDS KV Sbjct: 1 MELDLSPKLAKKLFGENGGSYFAWCPSELPMLREGNIGASKLALEKHGFALPRYSDSSKV 60 Query: 47 AYVLQGSGVAGIVLP 3 AYVLQGSGVAGIVLP Sbjct: 61 AYVLQGSGVAGIVLP 75 >ref|XP_002531105.1| nutrient reservoir, putative [Ricinus communis] gi|223529301|gb|EEF31270.1| nutrient reservoir, putative [Ricinus communis] Length = 356 Score = 127 bits (318), Expect = 1e-27 Identities = 62/75 (82%), Positives = 65/75 (86%) Frame = -3 Query: 227 MELDFSPKLAKQVYGGNGGSYHAWCPNDLPMLREANIAAAKLCLEKNGFALPKYSDSPKV 48 MELD SPKLA +VYGGNGGSY AW P+ LPMLRE NI AAKL L KNGFALP+YSDS KV Sbjct: 1 MELDLSPKLANKVYGGNGGSYFAWSPSQLPMLREGNIGAAKLSLVKNGFALPRYSDSSKV 60 Query: 47 AYVLQGSGVAGIVLP 3 AYVLQGSGVAGIVLP Sbjct: 61 AYVLQGSGVAGIVLP 75 >ref|XP_002310124.1| predicted protein [Populus trichocarpa] gi|222853027|gb|EEE90574.1| predicted protein [Populus trichocarpa] Length = 356 Score = 127 bits (318), Expect = 1e-27 Identities = 60/75 (80%), Positives = 67/75 (89%) Frame = -3 Query: 227 MELDFSPKLAKQVYGGNGGSYHAWCPNDLPMLREANIAAAKLCLEKNGFALPKYSDSPKV 48 M +D SPK+AK+VYGG+GGSY AWCP+DL MLRE NI AAKL LEKNGFALP+YSDS KV Sbjct: 1 MAIDLSPKVAKKVYGGDGGSYCAWCPSDLAMLREGNIGAAKLALEKNGFALPRYSDSAKV 60 Query: 47 AYVLQGSGVAGIVLP 3 AYVLQG+GVAGIVLP Sbjct: 61 AYVLQGNGVAGIVLP 75 >ref|NP_172255.1| cupin domain-containing protein [Arabidopsis thaliana] gi|8439891|gb|AAF75077.1|AC007583_13 Contains similarity to 12S seed storage globulin precursor gi|134919. ESTs gb|T13642, gb|T21684 and gb|T22751 come from this gene [Arabidopsis thaliana] gi|12248029|gb|AAG50106.1|AF334728_1 putative globulin protein [Arabidopsis thaliana] gi|15294234|gb|AAK95294.1|AF410308_1 At1g07750/F24B9_13 [Arabidopsis thaliana] gi|24111337|gb|AAN46792.1| At1g07750/F24B9_13 [Arabidopsis thaliana] gi|332190055|gb|AEE28176.1| cupin domain-containing protein [Arabidopsis thaliana] Length = 356 Score = 126 bits (316), Expect = 2e-27 Identities = 58/75 (77%), Positives = 66/75 (88%) Frame = -3 Query: 227 MELDFSPKLAKQVYGGNGGSYHAWCPNDLPMLREANIAAAKLCLEKNGFALPKYSDSPKV 48 MELD +PKL K+VYGG+GGSY AWCP +LPML++ NI AAKL LEKNGFA+P+YSDS KV Sbjct: 1 MELDLTPKLPKKVYGGDGGSYSAWCPEELPMLKQGNIGAAKLALEKNGFAVPRYSDSSKV 60 Query: 47 AYVLQGSGVAGIVLP 3 AYVLQGSG AGIVLP Sbjct: 61 AYVLQGSGTAGIVLP 75