BLASTX nr result
ID: Bupleurum21_contig00038014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038014 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB53034.1| photosystem I subunit XI precursor [Arabidopsis ... 92 3e-17 gb|ACG24344.1| photosystem I reaction center subunit XI [Zea mays] 92 3e-17 ref|NP_193016.1| photosystem I reaction center subunit XI [Arabi... 92 3e-17 dbj|BAA84771.1| photosystem I subunit PSI-L [Arabidopsis thaliana] 92 3e-17 ref|XP_002863290.1| predicted protein [Arabidopsis lyrata subsp.... 90 2e-16 >emb|CAB53034.1| photosystem I subunit XI precursor [Arabidopsis thaliana] Length = 219 Score = 92.4 bits (228), Expect = 3e-17 Identities = 44/54 (81%), Positives = 45/54 (83%) Frame = +3 Query: 3 APALTLTGRKKQPDQLQTADGWAKXXXXXXXXXISGVTWAYFLLYVLDLPYFVK 164 AP+LTLTGRKKQPDQLQTADGWAK ISGVTWAYFLLYVLDLPYFVK Sbjct: 166 APSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAYFLLYVLDLPYFVK 219 >gb|ACG24344.1| photosystem I reaction center subunit XI [Zea mays] Length = 219 Score = 92.4 bits (228), Expect = 3e-17 Identities = 44/54 (81%), Positives = 45/54 (83%) Frame = +3 Query: 3 APALTLTGRKKQPDQLQTADGWAKXXXXXXXXXISGVTWAYFLLYVLDLPYFVK 164 AP+LTLTGRKKQPDQLQTADGWAK ISGVTWAYFLLYVLDLPYFVK Sbjct: 166 APSLTLTGRKKQPDQLQTADGWAKFTRGFFFGGISGVTWAYFLLYVLDLPYFVK 219 >ref|NP_193016.1| photosystem I reaction center subunit XI [Arabidopsis thaliana] gi|18203449|sp|Q9SUI4.2|PSAL_ARATH RecName: Full=Photosystem I reaction center subunit XI, chloroplastic; Short=PSI-L; AltName: Full=PSI subunit V; Flags: Precursor gi|16226622|gb|AAL16216.1|AF428447_1 AT4g12800/T20K18_150 [Arabidopsis thaliana] gi|17933283|gb|AAL48225.1|AF446350_1 AT4g12800/T20K18_150 [Arabidopsis thaliana] gi|4586256|emb|CAB40997.1| probable photosystem I chain XI precursor [Arabidopsis thaliana] gi|7267981|emb|CAB78322.1| probable photosystem I chain XI precursor [Arabidopsis thaliana] gi|16649159|gb|AAL24431.1| probable photosystem I chain XI precursor [Arabidopsis thaliana] gi|20453409|gb|AAM19943.1| AT4g12800/T20K18_150 [Arabidopsis thaliana] gi|21592939|gb|AAM64889.1| probable photosystem I chain XI precursor [Arabidopsis thaliana] gi|332657786|gb|AEE83186.1| photosystem I reaction center subunit XI [Arabidopsis thaliana] Length = 219 Score = 92.4 bits (228), Expect = 3e-17 Identities = 44/54 (81%), Positives = 45/54 (83%) Frame = +3 Query: 3 APALTLTGRKKQPDQLQTADGWAKXXXXXXXXXISGVTWAYFLLYVLDLPYFVK 164 AP+LTLTGRKKQPDQLQTADGWAK ISGVTWAYFLLYVLDLPYFVK Sbjct: 166 APSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAYFLLYVLDLPYFVK 219 >dbj|BAA84771.1| photosystem I subunit PSI-L [Arabidopsis thaliana] Length = 124 Score = 92.4 bits (228), Expect = 3e-17 Identities = 44/54 (81%), Positives = 45/54 (83%) Frame = +3 Query: 3 APALTLTGRKKQPDQLQTADGWAKXXXXXXXXXISGVTWAYFLLYVLDLPYFVK 164 AP+LTLTGRKKQPDQLQTADGWAK ISGVTWAYFLLYVLDLPYFVK Sbjct: 71 APSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAYFLLYVLDLPYFVK 124 >ref|XP_002863290.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309124|gb|EFH39549.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 219 Score = 89.7 bits (221), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%) Frame = +3 Query: 3 APALTLTGRKKQPDQLQTADGWAKXXXXXXXXXISGVTWAYFLLYVLDLPYFVK 164 AP+LTLTGRKKQPDQLQTA+GWAK ISGVTWAYFLLYVLDLPY+VK Sbjct: 166 APSLTLTGRKKQPDQLQTAEGWAKFTGGFFFGGISGVTWAYFLLYVLDLPYYVK 219