BLASTX nr result
ID: Bupleurum21_contig00037700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037700 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152732.1| PREDICTED: diphthamide biosynthesis protein ... 102 3e-20 ref|XP_002283454.1| PREDICTED: DPH4 homolog isoform 3 [Vitis vin... 99 5e-19 ref|XP_002327129.1| predicted protein [Populus trichocarpa] gi|2... 92 3e-17 ref|XP_002510246.1| zinc finger protein, putative [Ricinus commu... 92 4e-17 ref|XP_003538970.1| PREDICTED: diphthamide biosynthesis protein ... 92 6e-17 >ref|XP_004152732.1| PREDICTED: diphthamide biosynthesis protein 4-like [Cucumis sativus] gi|449496015|ref|XP_004160012.1| PREDICTED: diphthamide biosynthesis protein 4-like [Cucumis sativus] Length = 173 Score = 102 bits (254), Expect = 3e-20 Identities = 48/66 (72%), Positives = 57/66 (86%) Frame = +2 Query: 5 GDVVELLYHCRCGDCFSIDSVELEEMGYLLSRDGDNISLQTLNSFPASVVLPCGSCSLKI 184 G+VVELLY CRCGD F IDS EL+EMGY L R+G +SL+TLN+ PASVVLPCGSCSLK+ Sbjct: 107 GEVVELLYQCRCGDYFFIDSGELDEMGYPLLRNGSKVSLRTLNALPASVVLPCGSCSLKV 166 Query: 185 RLLINN 202 RLLI++ Sbjct: 167 RLLIDS 172 >ref|XP_002283454.1| PREDICTED: DPH4 homolog isoform 3 [Vitis vinifera] gi|225432794|ref|XP_002283447.1| PREDICTED: DPH4 homolog isoform 2 [Vitis vinifera] gi|225432796|ref|XP_002283441.1| PREDICTED: DPH4 homolog isoform 1 [Vitis vinifera] Length = 182 Score = 98.6 bits (244), Expect = 5e-19 Identities = 46/65 (70%), Positives = 52/65 (80%) Frame = +2 Query: 5 GDVVELLYHCRCGDCFSIDSVELEEMGYLLSRDGDNISLQTLNSFPASVVLPCGSCSLKI 184 G V+EL Y CRCGD FS+DS EL EMGY + RDG ISLQT +S PAS +LPCGSCSLK+ Sbjct: 107 GKVLELFYQCRCGDYFSVDSSELGEMGYAVFRDGSKISLQTPDSLPASFILPCGSCSLKV 166 Query: 185 RLLIN 199 RLLIN Sbjct: 167 RLLIN 171 >ref|XP_002327129.1| predicted protein [Populus trichocarpa] gi|222835444|gb|EEE73879.1| predicted protein [Populus trichocarpa] Length = 182 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/65 (64%), Positives = 53/65 (81%) Frame = +2 Query: 5 GDVVELLYHCRCGDCFSIDSVELEEMGYLLSRDGDNISLQTLNSFPASVVLPCGSCSLKI 184 G++ E+ Y C+CGD FSIDS E E+MGY LSRD +IS+Q ++ PASVVLPCGSCSL++ Sbjct: 107 GEIFEMFYQCQCGDYFSIDSSEFEKMGYTLSRDECHISIQKPDALPASVVLPCGSCSLQV 166 Query: 185 RLLIN 199 RLLIN Sbjct: 167 RLLIN 171 >ref|XP_002510246.1| zinc finger protein, putative [Ricinus communis] gi|223550947|gb|EEF52433.1| zinc finger protein, putative [Ricinus communis] Length = 182 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/65 (63%), Positives = 53/65 (81%) Frame = +2 Query: 5 GDVVELLYHCRCGDCFSIDSVELEEMGYLLSRDGDNISLQTLNSFPASVVLPCGSCSLKI 184 G+ +EL Y CRCGD FS+DS+EL +MGY+L RD + IS +T + PASV+LPCGSCSL++ Sbjct: 107 GEALELFYQCRCGDYFSVDSLELGKMGYILLRDENKISFETTDVSPASVLLPCGSCSLQV 166 Query: 185 RLLIN 199 RLLIN Sbjct: 167 RLLIN 171 >ref|XP_003538970.1| PREDICTED: diphthamide biosynthesis protein 4-like [Glycine max] Length = 178 Score = 91.7 bits (226), Expect = 6e-17 Identities = 40/65 (61%), Positives = 51/65 (78%) Frame = +2 Query: 5 GDVVELLYHCRCGDCFSIDSVELEEMGYLLSRDGDNISLQTLNSFPASVVLPCGSCSLKI 184 G+ +EL Y CRCGD FS+DS+EL+ MGY L R+G IS+ +++ P SV+LPCGSCSLK Sbjct: 110 GEALELFYQCRCGDYFSVDSLELKNMGYSLLREGSGISIMNVDTSPGSVILPCGSCSLKA 169 Query: 185 RLLIN 199 RLLIN Sbjct: 170 RLLIN 174