BLASTX nr result
ID: Bupleurum21_contig00037373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037373 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002863224.1| hypothetical protein ARALYDRAFT_497141 [Arab... 114 6e-29 ref|XP_002888392.1| NADH dehydrogenase ND2 [Arabidopsis lyrata s... 81 1e-13 ref|XP_002519774.1| NADH dehydrogenase, putative [Ricinus commun... 55 5e-06 >ref|XP_002863224.1| hypothetical protein ARALYDRAFT_497141 [Arabidopsis lyrata subsp. lyrata] gi|297309058|gb|EFH39483.1| hypothetical protein ARALYDRAFT_497141 [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 114 bits (285), Expect(2) = 6e-29 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +2 Query: 179 WFSSFRDYEYNRSIRRQKDHPKMIISWLLRTNQIRWFYFSIFQICSYGTKIEKIEK 346 WFSSFRDYE NRSIRRQKDHPKMIISWLLRTNQIRWF+FSIF+ CSYGTK+EKIEK Sbjct: 139 WFSSFRDYECNRSIRRQKDHPKMIISWLLRTNQIRWFHFSIFRTCSYGTKVEKIEK 194 Score = 38.1 bits (87), Expect(2) = 6e-29 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = +1 Query: 343 KNKSFTTTDEGFLEKLRI 396 KN+SFTTTDEGFLEKLRI Sbjct: 194 KNQSFTTTDEGFLEKLRI 211 >ref|XP_002888392.1| NADH dehydrogenase ND2 [Arabidopsis lyrata subsp. lyrata] gi|297334233|gb|EFH64651.1| NADH dehydrogenase ND2 [Arabidopsis lyrata subsp. lyrata] Length = 425 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/49 (75%), Positives = 40/49 (81%), Gaps = 4/49 (8%) Frame = +2 Query: 173 HSW----FSSFRDYEYNRSIRRQKDHPKMIISWLLRTNQIRWFYFSIFQ 307 H W + RDYE NRSIRRQKDHPKMIISWLLRTNQIRWF+FSIF+ Sbjct: 127 HQWTPDVYEGVRDYECNRSIRRQKDHPKMIISWLLRTNQIRWFHFSIFR 175 >ref|XP_002519774.1| NADH dehydrogenase, putative [Ricinus communis] gi|223541013|gb|EEF42570.1| NADH dehydrogenase, putative [Ricinus communis] Length = 161 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 165 RCYIVGSHPSETTSIIGASVDKRITLR 245 RCYIVGSHPS+TTS+IGASVDKRITLR Sbjct: 135 RCYIVGSHPSKTTSVIGASVDKRITLR 161