BLASTX nr result
ID: Bupleurum21_contig00037345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037345 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002876478.1| hypothetical protein ARALYDRAFT_486331 [Arab... 62 4e-08 gb|AAV68865.1| hypothetical protein AT3G58770 [Arabidopsis thali... 62 6e-08 ref|NP_191436.1| uncharacterized protein [Arabidopsis thaliana] ... 62 6e-08 ref|XP_002520375.1| hypothetical protein RCOM_1192800 [Ricinus c... 61 8e-08 ref|XP_003633225.1| PREDICTED: uncharacterized protein LOC100854... 58 9e-07 >ref|XP_002876478.1| hypothetical protein ARALYDRAFT_486331 [Arabidopsis lyrata subsp. lyrata] gi|297322316|gb|EFH52737.1| hypothetical protein ARALYDRAFT_486331 [Arabidopsis lyrata subsp. lyrata] Length = 761 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -3 Query: 175 FSIREYALQMRSNDVLKCWPFGPKIEYVEAFLPPITVKKFKWWTDEL 35 FSIREY ++RS +V KCWPF + ++FLPPITV KF+WW+ EL Sbjct: 8 FSIREYTKKVRSENVRKCWPFAGDL--FQSFLPPITVSKFRWWSHEL 52 >gb|AAV68865.1| hypothetical protein AT3G58770 [Arabidopsis thaliana] Length = 771 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -3 Query: 175 FSIREYALQMRSNDVLKCWPFGPKIEYVEAFLPPITVKKFKWWTDEL 35 FSIREY ++RS++ KCWPF + +++FLPPITV KF+WW+ EL Sbjct: 8 FSIREYTEKVRSDNERKCWPFAGDL--IQSFLPPITVSKFRWWSHEL 52 >ref|NP_191436.1| uncharacterized protein [Arabidopsis thaliana] gi|7630072|emb|CAB88294.1| putative protein [Arabidopsis thaliana] gi|332646307|gb|AEE79828.1| uncharacterized protein [Arabidopsis thaliana] Length = 771 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -3 Query: 175 FSIREYALQMRSNDVLKCWPFGPKIEYVEAFLPPITVKKFKWWTDEL 35 FSIREY ++RS++ KCWPF + +++FLPPITV KF+WW+ EL Sbjct: 8 FSIREYTEKVRSDNERKCWPFAGDL--IQSFLPPITVSKFRWWSHEL 52 >ref|XP_002520375.1| hypothetical protein RCOM_1192800 [Ricinus communis] gi|223540422|gb|EEF41991.1| hypothetical protein RCOM_1192800 [Ricinus communis] Length = 259 Score = 61.2 bits (147), Expect = 8e-08 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = -3 Query: 175 FSIREYALQMRSNDVLKCWPF---GPKIEYVEA-FLPPITVKKFKWWTDELENKAMEDK 11 FSIREY +MR DV KCWPF G E VEA LPPITV KF+WW+ EL NK + K Sbjct: 9 FSIREYTEKMRVVDVEKCWPFSGGGGDKEQVEATLLPPITVTKFRWWSHEL-NKINQQK 66 >ref|XP_003633225.1| PREDICTED: uncharacterized protein LOC100854859 [Vitis vinifera] Length = 238 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/51 (52%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = -3 Query: 181 ERFSIREYALQMRSNDVLKCWPF-GPKIEYVEAFLPPITVKKFKWWTDELE 32 E FSIR+Y +MRS DV+KCWPF G LPP+ V KF+WW+ E+E Sbjct: 6 EGFSIRDYVWRMRSVDVVKCWPFDGDGHGDESVLLPPMEVPKFRWWSHEVE 56