BLASTX nr result
ID: Bupleurum21_contig00037327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037327 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619357.1| Cc-nbs-lrr resistance protein [Medicago trun... 57 2e-06 ref|XP_003619345.1| HAT family dimerization domain containing pr... 57 2e-06 >ref|XP_003619357.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|355494372|gb|AES75575.1| Cc-nbs-lrr resistance protein [Medicago truncatula] Length = 2054 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = -1 Query: 186 IEISNDLAKEGEPVGNKLKSEAWLHFDKVKIDGVMKAVCKYCKAKLRGDSGCGTSHFLCH 7 ++ +++A+ E +L+SEAW HF ++K++G KA CKYCK L G S GT H L H Sbjct: 135 MDTGDNIAELAENENMRLRSEAWKHFTRMKVNGEDKAQCKYCKKLLGGKSRNGTKHLLQH 194 >ref|XP_003619345.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355494360|gb|AES75563.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 254 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = -1 Query: 186 IEISNDLAKEGEPVGNKLKSEAWLHFDKVKIDGVMKAVCKYCKAKLRGDSGCGTSHFLCH 7 ++ +++A+ E +L+SEAW HF ++K++G KA CKYCK L G S GT H L H Sbjct: 135 MDTGDNIAELAENENMRLRSEAWKHFTRMKVNGEDKAQCKYCKKLLGGKSRNGTKHLLQH 194