BLASTX nr result
ID: Bupleurum21_contig00037237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037237 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAT79815.1| Rop-interacting receptor-like cytoplasmic kinase... 71 1e-10 ref|XP_002531039.1| ATP binding protein, putative [Ricinus commu... 71 1e-10 ref|XP_003610091.1| Receptor-like protein kinase [Medicago trunc... 70 1e-10 ref|XP_002269944.1| PREDICTED: probable receptor-like serine/thr... 69 3e-10 emb|CAN73454.1| hypothetical protein VITISV_023493 [Vitis vinifera] 69 3e-10 >emb|CAT79815.1| Rop-interacting receptor-like cytoplasmic kinase 1 [Medicago truncatula] Length = 381 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = +3 Query: 3 YNINQLNRLAFAASLCIRKSSTWRPIMSEVLQVMLLEGEINEERWKIPK 149 Y+I QL RLAFAASLCIR SSTWRP M+EVL++M EGE+++E+WK+P+ Sbjct: 300 YDITQLKRLAFAASLCIRASSTWRPSMTEVLEIM-EEGEMDKEKWKMPE 347 >ref|XP_002531039.1| ATP binding protein, putative [Ricinus communis] gi|223529392|gb|EEF31356.1| ATP binding protein, putative [Ricinus communis] Length = 266 Score = 70.9 bits (172), Expect = 1e-10 Identities = 38/70 (54%), Positives = 43/70 (61%) Frame = +3 Query: 3 YNINQLNRLAFAASLCIRKSSTWRPIMSEVLQVMLLEGEINEERWKIPKXXXXXXXXXXX 182 Y+ QL RL FAASLCIR S TWRP MSEVL+VM EGE ++ERWK+PK Sbjct: 179 YDAIQLRRLGFAASLCIRASPTWRPTMSEVLEVM-QEGETDKERWKMPKEEEQEEFWGFE 237 Query: 183 XXXCECDSIS 212 ECD S Sbjct: 238 DLEYECDDSS 247 >ref|XP_003610091.1| Receptor-like protein kinase [Medicago truncatula] gi|355511146|gb|AES92288.1| Receptor-like protein kinase [Medicago truncatula] Length = 381 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/49 (65%), Positives = 43/49 (87%) Frame = +3 Query: 3 YNINQLNRLAFAASLCIRKSSTWRPIMSEVLQVMLLEGEINEERWKIPK 149 Y++ QL RLAFAASLCIR SSTWRP M+EVL++M EGE+++E+WK+P+ Sbjct: 300 YDVTQLKRLAFAASLCIRASSTWRPSMTEVLEIM-EEGEMDKEKWKMPE 347 >ref|XP_002269944.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Vitis vinifera] gi|297735406|emb|CBI17846.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +3 Query: 3 YNINQLNRLAFAASLCIRKSSTWRPIMSEVLQVMLLEGEINEERWKIPK 149 Y++ QL RL FA+SLCIR SS WRP MSEVL+ M L GEI+EERWK+P+ Sbjct: 303 YDVAQLKRLTFASSLCIRSSSIWRPTMSEVLEAM-LGGEIDEERWKMPE 350 >emb|CAN73454.1| hypothetical protein VITISV_023493 [Vitis vinifera] Length = 301 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +3 Query: 3 YNINQLNRLAFAASLCIRKSSTWRPIMSEVLQVMLLEGEINEERWKIPK 149 Y++ QL RL FA+SLCIR SS WRP MSEVL+ M L GEI+EERWK+P+ Sbjct: 218 YDVAQLKRLTFASSLCIRSSSIWRPTMSEVLEAM-LGGEIDEERWKMPE 265